SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000013403 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000013403
Domain Number 1 Region: 393-555
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.83e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 166-287
Classification Level Classification E-value
Superfamily PH domain-like 0.0000002
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 3 Region: 72-212
Classification Level Classification E-value
Superfamily PH domain-like 0.0000246
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 4 Region: 28-60
Classification Level Classification E-value
Superfamily WW domain 0.0000267
Family WW domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000013403   Gene: ENSMEUG00000014674   Transcript: ENSMEUT00000014723
Sequence length 557
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_9040:56969:71392:-1 gene:ENSMEUG00000014674 transcript:ENSMEUT00000014723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGETTWESPFGPPESASSPATSLSPLGSPRDPEAEWDQYWDEESRRVFFYNPLTGETAWE
ESITPEMQTELAPCSPMDQRPPTPEADYPEELTGYPEEDYSPGSSYTDPIPGSPPGWSCH
ITPDGHLLYTNLYTQEQVPVSAPRSGSKSSQNIDSLTLGSPPEEKSKTLDKAGVLHRTKT
VDKGKRLRKKNWSPSWTVLEGGILTFFKESKASIAGSLXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXLRSRDGCEYLIQHDSEAIIGTWYKAISQGIQEQSTDAHPETDSENSA
DFGSSERLGGGREKEEEKKLSEVSPTGPENDSSKVRHKLRKFLLRRPTLQSLRDKGYIKX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDIDGLYRISGNLATIQKLRYKVDHDE
RLDLDDGRWEDVHVITGALKLFFRELPEPLFPFSHFRQFIAAIKLQDQTQRSCCIRDLVH
SLPAPNHNTMRLLFQHLCRVIEHKEKNRMSVQSVAIVFGPTLLRPELEEGNMPMTMVFQN
QVVELILQQCRDIFPPC
Download sequence
Identical sequences ENSMEUP00000013403 ENSMEUP00000013403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]