SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000013507 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000013507
Domain Number 1 Region: 211-421
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-76
Family Nuclear receptor ligand-binding domain 0.0000000092
Further Details:      
 
Domain Number 2 Region: 23-97
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.08e-25
Family Nuclear receptor 0.0000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000013507   Gene: ENSMEUG00000014791   Transcript: ENSMEUT00000014838
Sequence length 426
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_2574:419:20773:-1 gene:ENSMEUG00000014791 transcript:ENSMEUT00000014838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVGMAASTSFPDPSYGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALF
TCPFNGDCRITKDNRRHCQACRLKRCVDIGMMKEXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXTMEPFSNLVLSEDSEDPSVTLDLSQLSMLPHLADLVSYSIQKV
IGFAKMIPGFRDLSSEDQIVLLKSSAIEVIMLRSNQSFTMDDMSWTCGSQEFKYRVSDVA
KAGHNLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALVEAIQDRLSN
TLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPEHSMKLTPLVLEV
FGNEIS
Download sequence
Identical sequences ENSMEUP00000013507 ENSMEUP00000013507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]