SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000013654 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000013654
Domain Number 1 Region: 189-323
Classification Level Classification E-value
Superfamily C-type lectin-like 4.81e-29
Family C-type lectin domain 0.00093
Further Details:      
 
Domain Number 2 Region: 1081-1199
Classification Level Classification E-value
Superfamily C-type lectin-like 1.05e-26
Family C-type lectin domain 0.002
Further Details:      
 
Domain Number 3 Region: 2-126
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.76e-24
Family Cysteine rich domain 0.0039
Further Details:      
 
Domain Number 4 Region: 943-1064
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-23
Family C-type lectin domain 0.0022
Further Details:      
 
Domain Number 5 Region: 398-467
Classification Level Classification E-value
Superfamily C-type lectin-like 3.32e-16
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 6 Region: 696-763
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000367
Family C-type lectin domain 0.002
Further Details:      
 
Domain Number 7 Region: 831-884
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000332
Family C-type lectin domain 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000013654
Domain Number - Region: 1248-1285
Classification Level Classification E-value
Superfamily C-type lectin-like 0.084
Family C-type lectin domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000013654   Gene: ENSMEUG00000014943   Transcript: ENSMEUT00000015005
Sequence length 1419
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6088:27650:117960:-1 gene:ENSMEUG00000014943 transcript:ENSMEUT00000015005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGIFIIQNEDLKTCIQASKFGLTLENCNQPTTSMLWKWVSKRHLYNIGTSTCLGLNLSIP
EQPLGLFECDSTYFSMWWRCYRKVVIGAYQYKLEVENRNLVVATRQSSQKWMQYMSGGDD
ICERPFQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXSTVISCEVFWEKDPNTHICYQFNLFSILSWSEAHSSCKMQGGDLLSIMDGAEEN
FIRQHLSSKAVDVWIGLNQLDAAAGWQWSDGTPLTYLNWSPDVKFDPLLEHHCGTFNSLM
AQSWRNHECESGLPYVCKKYLNHTEHEAFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNVSETWIGMSSHSNPVSFEWSNGSL
VTFTNWHTQEPNISFNRSQLCVSAQQSEGQWEVKNCEEKISYVCKKTGHVLSETKSGCHE
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYSGGCVVIRGRNPPGFWEVKDCRRF
KAMSLCKQPVTARRETEHEERWPFHPCFLGWESKPSLTSCYKXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTEERQFWIGFNKRNPLSEGSWEWSDGTPV
VASFLENTYFGEDTRNCAVYQANKTLLPLPCGSKREWICKIPRDVKPKIPKWYMHXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSKNNTNWWIGL
REDRPDDGFHWRDGSPLIYQNWDDGGQRSVNNQSQRCGFISSKTXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCFLVEIPKDPRYLKTWENAQNFCAEEDAT
LASIQNEVEQAFITMNLFGQKANVWIGLQSDDYEKWLNGEPVIYSNWSPVEIINSKNHNS
TNVQEQVPLCALLSSNPNFHFTGKWYLEDCRKKSFGFVCEKTQDPSGHNINASNMYPIPE
TLEYGNKTYKIISANMTWHAALKACMESGAELVSITDQFHQSFLTIIINRLGHAHWIGLF
TSDNGLNFEWSDGTKPYFTYWEDEASSSVGACTFVALNGRWRRTDCETPLQGAICHVPKX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXANLLTIKDEAENA
YLLKELYAFSSSIPMVWLNAQFDNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXINNMKPGEAPNHSLIPLTIAVMLFAILGISTFFYC
LSKQNGGFFRRFAVFYTSTNLRRLPVDESILISDLERND
Download sequence
Identical sequences ENSMEUP00000013654 ENSMEUP00000013654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]