SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000013803 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000013803
Domain Number 1 Region: 199-293
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.18e-23
Family Nuclear receptor ligand-binding domain 0.00000761
Further Details:      
 
Domain Number 2 Region: 4-28
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000275
Family Nuclear receptor 0.0083
Further Details:      
 
Domain Number 3 Region: 402-445
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0000996
Family Nuclear receptor ligand-binding domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000013803   Gene: ENSMEUG00000015126   Transcript: ENSMEUT00000015165
Sequence length 457
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_771:9483:14802:-1 gene:ENSMEUG00000015126 transcript:ENSMEUT00000015165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIEIIPCKICGDKSSGIHYGVITCEGCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTY
NITTNGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICD
YTPASGFFPYCSFTNGETSPTVSMAELXXXXXXXXXSHMETCQYLREELQQITWQTFLQE
EIENYQNKQREVMWQLCAVKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLICKVSTLRALCGRHTE
KLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
Download sequence
Identical sequences ENSMEUP00000013803 ENSMEUP00000013803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]