SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000013805 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000013805
Domain Number 1 Region: 81-283,332-423,451-476
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 6.1e-40
Family Diacylglycerol kinase-like 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000013805
Domain Number - Region: 6-75
Classification Level Classification E-value
Superfamily PH domain-like 0.019
Family Pleckstrin-homology domain (PH domain) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000013805   Gene: ENSMEUG00000015125   Transcript: ENSMEUT00000015167
Sequence length 489
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_1607:6757:38837:-1 gene:ENSMEUG00000015125 transcript:ENSMEUT00000015167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TCSVPVSEIITVEETEIDEKHYHSGKWQKMAKPYAFTVYYVKRARRHRWRCSHVTFWCSD
ETLCNQWIQTLKELLEKLTCRPKHLLVYINPFGGKRQGKRIYEQKVEPLFNLASVTTDVI
XXXXXXXXXXXXXXXXXXXXXXIVCVGGDGMFSEVLHGLIGRTQKDCGIDQNNPKASLVQ
CSLRIGIIPAXXXXXXXXXXXXXXXXXXXXXXXXXXDSLSMDVSSVHHNNEFLKYSVSLL
GYGFYGDILRDSEKKRWMGLIRYDFSGFKTFLSHHCYEGTVAFLPAQHTVGSPRDKKPCR
MGCFICRQSKQQLEDEQKKSLYGLENTEEVEEWKVIQGKFLAINAANMSCACPRSPKGLS
PVAHLADGSSDLILVRKCSRLNFLRYLIRHTNQDDQFDFAFVEVYRVRKFQFMSKQLEDE
DGDLKDLGKKGFGHICSDHPACCCPLPNSTWNCDGEILNNSAIEVRVHCQLLQLFARGIE
ETPTQEVLS
Download sequence
Identical sequences ENSMEUP00000013805 ENSMEUP00000013805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]