SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000013860 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMEUP00000013860
Domain Number - Region: 132-196
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00763
Family Link domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000013860   Gene: ENSMEUG00000015174   Transcript: ENSMEUT00000015224
Sequence length 931
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_976:4511:40336:1 gene:ENSMEUG00000015174 transcript:ENSMEUT00000015224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARGSDSEDDLVTYGTGLEPLEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXPSTFISSRQNRADKAVLGPEDFMDEEDLSEFGIAPKAIITTDDFASKT
KDRIREKARQLAAAAAPIPGATILDDLIAPAKLSIGFELLRKMGWKEGQGVGPRVKRKPR
RQKPVPGVKIYGCALPPTGSEGSEDDDDDYLPDNVTFAPKDTTPVDFTPKDNVHGLAYKG
LDPQKALFGISGEHFNLFDDVSEGTSNLLGSIRPNKGRKLGISGQAFGVGALEDEDDDIY
ATETLSKYDTVLKDEEPGDGLYGWTAPMQYKSRKGSEKDIRYVGKILDGFSLAXXXXXXX
XIYPPPELPKDYRPVHYFRPVITAASENSHLCQXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXSTTSILEFLSQKDKERINEMKRTTEVKAAEIKAKALVPKAWNSRFQPDSP
HDAIHSMVLSADVAAGRSSDFRPFAKDPEKQKRYEKYLGSIKQGQKDALESCLDPRMTEW
ERGRERDEFVRAAVLYKPSSSSLSSRFTHAKQEDDTDQVEVPRDQENDVDDKLSAVKMKM
FGKLTRDKFEWHPDKLLCKRFNIPDPYPDSTIVGLPKVKRDKYSVFNFLTIAEPTTLTTT
QVSNERAQQNHSRNKARKPSRWDIPDQEEKKEDSISEFLSMARSEAEIQKQQLRPLVNNA
EGSTAEPSSAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKKHKKHKQKGKQKNKKTEKSSSSESVD
SSDSQSDTEKVKDISPQELLRRLKRLPLTKK
Download sequence
Identical sequences ENSMEUP00000013860 ENSMEUP00000013860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]