SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000013878 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000013878
Domain Number 1 Region: 268-447
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.42e-29
Family FCH domain 0.022
Further Details:      
 
Domain Number 2 Region: 3-72
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-18
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 75-104
Classification Level Classification E-value
Superfamily WW domain 0.0000049
Family WW domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000013878   Gene: ENSMEUG00000015199   Transcript: ENSMEUT00000015246
Sequence length 449
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_127:4417:55658:-1 gene:ENSMEUG00000015199 transcript:ENSMEUT00000015246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSRCQTLYPFSGERHRQGLRFDAGEVLTVLQVPDGGWWEGQKEDGLRGWFPASYVQLL
EKPGMVPPQPTEESQTSLLPPGWQSYLSPQGRRYYVNTTTNXXXXXXPNGSPRTPSSPGP
QRNFQPATXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPGSPSPGKKQSKESTLTXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLGEAWAQVKKSLADEAEVHLKFSSKLHSEV
EKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKARKALTERQKDLEMKTQQLEIK
LSNKTEEDIKKARRKSTQAELERLEVERVEMIRQHLCQYTQLRHETDMFNQSTVEPVDQL
LRKVDPAKDRELWVKEHKTGDIRPVDMEI
Download sequence
Identical sequences ENSMEUP00000013878 ENSMEUP00000013878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]