SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014136 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014136
Domain Number 1 Region: 19-170
Classification Level Classification E-value
Superfamily C-type lectin-like 9.1e-21
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 2 Region: 397-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000077
Family EGF-type module 0.0016
Further Details:      
 
Domain Number 3 Region: 276-399
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000298
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 4 Region: 234-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000342
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014136   Gene: ENSMEUG00000015491   Transcript: ENSMEUT00000015530
Sequence length 566
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_8521:2737:4789:-1 gene:ENSMEUG00000015491 transcript:ENSMEUT00000015530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLSLLSLPTMAELGLPASPISQPGGSQCIEDDCYAVFWNPEKFAGANKVCQQLGGHLMTV
RSSVAADVISLLAQGTPEIHPQRLWIGLQLGQNCSHEQEGRLRGFRWVTGDNSTSYSKWA
QGGGALCGHQCVVVSGDSASGSMELVWEEHSCDLATEGFLCEYNYPGSCKPLNLEPSIVA
SVTYSTPFGGKGADFQALPLHSHALVVPLGLDLVCKKVEETPRWVKESLGPWDCRVEKGG
CSQICRQDSGDPECLCPQGTLSKADLRSCQAEGNSCPHNHCQQHCEVSSKTPSGYICMCH
TGYYLGEDGHSCVDVDDCALEPNPCPQKCVNTHGAFKCECNPGFELIDGECVEMVDPCSL
FGSKCEHDCLPLEGGTYRCVCKEGFLPIPDQPDRCMLFCNTTACPAKCNPYNADDCKCPE
GYILDENQMCSDIDDCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXESSFTQTPDTTTSPPAEGPVHSVVLMGTAISILSIVTVLLAIFCHLRKKQCAAQAA
LDYKCAGSAKEEVLQQVRTESVPQKL
Download sequence
Identical sequences ENSMEUP00000014136 ENSMEUP00000014136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]