SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014138 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014138
Domain Number 1 Region: 1-177
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.62e-46
Family FCH domain 0.000000071
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000014138
Domain Number - Region: 393-464
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 0.000353
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014138   Gene: ENSMEUG00000015483   Transcript: ENSMEUT00000015532
Sequence length 545
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_3721:32939:43462:1 gene:ENSMEUG00000015483 transcript:ENSMEUT00000015532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWGSELWDQFEVIERHTQWGLDLLDKYVKFVKERTEVEQSYAKQLRSLVKKYLPKRSTK
DDPESKFSQQQSFMQVLQELNDFAGQRELVAENLTVQVCLELTKYSQDIKQERKMHFQEG
RRAQQQLENGLKQLENSKRKFERDCREAEKAAQTAERLDQDINATKADVEKAQAHVRSHM
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXDSQVLIGLHKSGFTRPGDVEFEDFSQPMTRAPSDSSLGV
PPDGRPDPRGPVRNRPKRWPFGRKNKLPPPPLSPLGGPSSAYANGPPSPRFGRDPLALLS
EISKSVKPRIASFRSLRSRGTVATEDFSHLPPEQRRKKLKQQLEDRGRELQKEIDQREAL
KKMKDVYEKTPQMGDPASLEPRISETLSNIERLKLEIQKYEMWLAEAENRVLGSRRDSLG
HHGHPPEPPTGAPPDTNNCSPDKESPEAPPSDEGTDTSIYTEFEEDFEEEPAFPIGHCVA
VYQFE
Download sequence
Identical sequences ENSMEUP00000014138 ENSMEUP00000014138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]