SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014161 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014161
Domain Number 1 Region: 47-185
Classification Level Classification E-value
Superfamily C-type lectin-like 7e-31
Family C-type lectin domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014161   Gene: ENSMEUG00000015514   Transcript: ENSMEUT00000015556
Sequence length 379
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_9833:1854:27321:1 gene:ENSMEUG00000015514 transcript:ENSMEUT00000015556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPRAALTALLTAVLAWPREGGTRLLSASDLDLRGGQPICRGGTQRPCYKVVYFHDASRR
VNFDEASMACRRDGGQLVSVESEDEQRLIEKFIENLLASDGDFWIGLRRSEENQGNNTAC
PDLYTWTDGSTSTFRNWYVDEPSCGSEVCVVMYHQPSAPVGIGGPYMSQWNDDRCNMKNN
FICKYSEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTELNLAYILIPSI
PLFLLLVVITVICWFWIYGRRKREQTESTKEPNIWPAPHRRNSPDLEVYNVIRKQSEADL
TEPRPDLKNISFRARSGGATSNDLSCDYDNIVVNASESGFVTLASMESGFVANDIYELSP
ERMGRNKESGWVENEIYGY
Download sequence
Identical sequences ENSMEUP00000014161 ENSMEUP00000014161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]