SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014202 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014202
Domain Number 1 Region: 111-309
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-34
Family Pentraxin (pentaxin) 0.00038
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000014202
Domain Number - Region: 44-99
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0837
Family BAR domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014202   Gene: ENSMEUG00000015563   Transcript: ENSMEUT00000015600
Sequence length 320
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_7586:10350:14260:-1 gene:ENSMEUG00000015563 transcript:ENSMEUT00000015600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRRFQEVTLIRLQGIAENYNVSYNINTRFQNLTDEYHTMAMSVNESQAAVQMDLNHLKAW
MKKIQRRSRKVDSKILAFERSLNEKSKQSSQEKMKQKEESTLPISLGLCNVGSMLVFPNT
STENVVTFSPGFLTGLRELSICTWVQTSSSYLGTLLSYATEENDNKLVLHGRDTLVYGTI
HFVIGDPAFRELPVELLLDSRWHHMCVIWSSIQGKYWFYVDRRLVATGSRFREGYEIPPG
GRLVLGQEQDTVGGGFDSSEAFVGSLAGLTMWDRALSPGEVSSVATGKVLPRNILLTLAN
ASSLDGFVKRVICTCLEHCL
Download sequence
Identical sequences ENSMEUP00000014202 ENSMEUP00000014202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]