SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014285 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014285
Domain Number 1 Region: 6-156
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.31e-28
Family FCH domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014285   Gene: ENSMEUG00000015628   Transcript: ENSMEUT00000015688
Sequence length 844
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4000:3515:45128:1 gene:ENSMEUG00000015628 transcript:ENSMEUT00000015688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEKNHGFDVLYHSMKQGQVSTKELADFIRERATVEETYSKAMAKLAKMAGNGTPMGTFAP
LWEVFRVSSDKLALCHMELTKKLNDLIKDVVRYGEEQSKAHKKCKEEAVGTLEAVQALHG
VSQILPKSRESYVSRCLELDRLRKEGTNQKEIDKXXXXXXXXXXXXXXXXXXXXXXRADF
ERKMLESALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXVVDFEEYSSMALPEGRPFRIPGLSRREREHRPSDSPEAESVXXXX
XXXXXXXXXXXXXXXXAGEPTLLSSSDSDYDDEEEPRKFFVQIKPAPAQPARDTEAAAAQ
LKATAGSLILPPGPGGTMKRHSSRAAGKPLRPHSASRAIRCAEKPQSDVQLSKALFGPPL
ESTLEPEDFPGSGSYGLTSSPSPFSSSSPENVEDSGLDSPSHPAPGPSPDSWVPRPATPQ
SPPVARRPVPHQPGPTPPAWTASDLLPTLPYAGVREGQAVLPRRGHSRKTPSALTRSNGD
LSRSLSPSPLSSSVPSSLPERSSGFSQSGLGISRGPSPVVLGSQDALPVATAFTEYIHAY
FRGQDAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLEEKRLLW
RLPDVSEEGGQGHLSASWEPLSGPSMPGPVAAHFTSEGSTLSGVDVELVGSGYRMSLVKR
RFAT
Download sequence
Identical sequences ENSMEUP00000014285 ENSMEUP00000014285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]