SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014397 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014397
Domain Number 1 Region: 1374-1478
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 3.24e-30
Family Lipoxigenase N-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 7-80
Classification Level Classification E-value
Superfamily C-type lectin-like 3.78e-16
Family C-type lectin domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014397   Gene: ENSMEUG00000015732   Transcript: ENSMEUT00000015812
Sequence length 2395
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_5115:3348:117148:-1 gene:ENSMEUG00000015732 transcript:ENSMEUT00000015812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLRTIDPQKSGFCSENQMAFNHSCYEFVGHKRPFASAQKWCERQGGHLVFINNPGTQQF
LERNIPEEREWWIGLTWNSAQNEIAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXQCHGLQACQVTADGEFFGDMCPSLGSYLWIQYHCVEG
LQVIVPNACFVSENITISLTWLLSPYTGNLSCIINTGDGTVIDPYYPPXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXTGVTYTVLSDNITLAESSIQEGVIPHNLTLVSTARLQPGVHHLEICAVSHITTS
KLSRNLTVHIIEPLSGLQAFWVSDHLEMGQDLLINVSVAQGSPEELTFEVTGASGNFSYV
KQCLGKESRVYSIPIPEKGTFLVTVLAQNLFSNLSLTIGRVSVSXXXXXXXXXXXXXXXX
XKDKGKSQLYIKPSRYVDPFTMVTLGWPDYNKSLNFVWSCXXCWPQWRECVQQQLIFTDQ
REMLIDPFCLPPPNSAITLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXMTKWAYGEQTYIVSTLYPPEVPACSVIPEQGTILTSFRISCS
TSAEPGLLIYCFCLKSDSCLYCGHEPELPSVYLPLGEEENNFVLKILISVANKAGDTVHT
HVAVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMAEALKDVTFRHEELSPIAQMVASHV
LWNISKSLATNIPEDGTGRQKHQMTAMHLFHAVGNVLEVSRSQEPEEPLGSGTSQXXXXX
QLLGTLENLQSALLLGRPPRDHPTMLSVPTISMYINRVQPHGLDGASFHLNMSNSAVFIL
PSIASFNSLGDDDEPVDIRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXIVLPLQSSTQTVLNLTTSATLQVNMTSGNASLVIHLEWDFDLPLTLYLGYGYHPNET
SYDVKTHLHPKTALTGKLATWILSAEQLPFGEGTYYVKVIPAPELDPAAHHDVTVSVTCF
ISQCVFWDELQEEWRGDGCQVGSQTTLYSTHCLCNHLTFFGSTFFVMPNIVDVSQTTELF
GTFVDNPVVVTTVGCLCVVYVMVAFWARRKDIQDNAKVKITVLEDNDPFARYHYLVTVFT
GHRRGAATTSKVTVTLYGLEGESEPHHLSDPETPVFERGGVDVFLLATLFPLGELQSIRL
WHDNSGDRPSWYVNRVSVHDLTLDQKWYFLCNSWLSIDVGDCVLDRRFPVATEQDMKQFS
HLFFMKTSKGFQDGHIWYSIFSRSPRSSFTRVQRVSCCFSLLLCTMLTSIMFWGIPKDPA
EQKMDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATRPQNQEGKNWLEQLQSLSLYAPSTH
RERTRTSWASFPGSESCPGNDAGPDPEKPTGPASKALPGLPWWFALIGWLLIVSTSGVAA
FFTMLYGLHYGKDNSIKWLLSMAVSFVESVFITQPLKXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFPR
PGIKGQTCYEANPSGANSQSIEEEAMCIWGQIQRTHQGRILQYLFNNTWLDTFTRAVFVE
FTVYNANVNLFCIVTLIFETNAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXGQLMKSQKWSYFQSKWNLLELAIILISWSALSVFVKRTILGARDIQYYLTHKDK
AVSFGQTARADAVLGYLIAVLVLLSTVKLWHLLRLNPKLNVLTSSLRRAWGDISGFIIVM
AVMFLAYSIATNLIFGWNLHSYKTLFDAVETMVSLQLGIFNYEEVLDSNPVLGSFLIGSC
IIFMTFVVLNLFISVILVAFSEEQKYHQPSEEEEIVDLVLMKIFSFLGIKCKKSE
Download sequence
Identical sequences ENSMEUP00000014397 ENSMEUP00000014397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]