SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014510 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014510
Domain Number 1 Region: 2-255
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.62e-70
Family FCH domain 0.000000000498
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000014510
Domain Number - Region: 396-467
Classification Level Classification E-value
Superfamily HR1 repeat 0.0112
Family HR1 repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014510   Gene: ENSMEUG00000015877   Transcript: ENSMEUT00000015929
Sequence length 553
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_9185:1877:77267:-1 gene:ENSMEUG00000015877 transcript:ENSMEUT00000015929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DQFDNLEKHTQWGIDILEKYIKFVKERTEIEISYAKQLRNLSKKYQPKRNSKEEEEYKYT
SCKAFISTLNEMNDYAGQHEVISENMTSQITVELARYVQELKQERKSHFHDGRKAQQHIE
TCWKQLESSKRRFERDCKEADRAQQYFEKMDADINVTKADVEKARQQAQLRHQMAEDSKA
DYSSALQKFNHEQREHYCTHIPSIFQKIQEMEERRIVRIGESMKTYAEVDRQVIPIIGKC
LDGIAKAAESIDQKNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXLMSLLTSPHQPPPPPPASASPSAVPNGPQSPKQQKEPLS
HRFNEFMTSKPKIHCFRSLKRGXXXXGAGPEDFSNLPPEQRRKKLQQKVDELNKEIQKEM
DQRDAITKMKDVYVKNPQMGDPDSLDHKLIEVGQNIEKLRLEVQKFEXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXPDGSYTEEQSQENELKMMATDFDDEFDDEEPL
PTIGTCKALYTFE
Download sequence
Identical sequences ENSMEUP00000014510 ENSMEUP00000014510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]