SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014683 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014683
Domain Number 1 Region: 500-725
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.57e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.0000915
Further Details:      
 
Domain Number 2 Region: 84-287
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.25e-21
Family FCH domain 0.057
Further Details:      
 
Domain Number 3 Region: 445-495
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000145
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014683   Gene: ENSMEUG00000016054   Transcript: ENSMEUT00000016111
Sequence length 847
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_3710:557:8794:-1 gene:ENSMEUG00000016054 transcript:ENSMEUT00000016111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEAGSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVEMLVGDSEPLDNPEPISETQSWS
SPFPGDPVLLTGEELDTRLVRSEGGVEAALDYAKMWSRHLKEILSWTEKRANYELEFSKN
IMKLAEAAKVSIRQQDVYGLFLEQDFILGDLTLQILAQQKQNYYQPLVAQRNEIEKRRKE
MKAQWAREQKRMNEAVLALRRARVQYLQRSEDAQARISGLPEIPSKQQERRRRSREDAQA
KALEAETHYQACIREANLRQRDLEATKQRIVSCVRKMLLQGDVELKKXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLDTRK
KVPSQQSLQSNESLLELNPWEDPGHGSLGISLGSDVDSIGGSSETRSLDSPTSSPSPHSE
FSDNLQKRELGDGADNEKKWTLSSAAQTHRFRKLRGPAKCRECETFMVSGIECEECSLAC
HKRCQQSLLILCGHRKLPARTQLFGVDFLQLPRDFPEEVPFLVIKCTAEIEHRALSVQGI
YRISGSRVRVERLCQAFENGWALVELSDNSPHDVTGVLKHFLKELTDSIIPSQLYGAFIS
LAKTLQPEVSSNASGNSEPELSLDPSPNADPAAEAVSALRTLLRQLPGSNYNTLRHLVAH
LFRVASRFEENKMSANNLGIVFGPTLLRPPKGQGGVSTSPATCLLDSGYQAQMIEFLIVH
YEHVFGMEELPPTTDFDQVREETPLGTQSRGHFSRQPVKYPRAGGVKPVIHQLSSLALVA
SKLCEEAPIGAGSLRGQGPWTGASPEGSPLRRAKLPKHFEITQETARLLSKREKGLRIPC
CPESEPQ
Download sequence
Identical sequences ENSMEUP00000014683 ENSMEUP00000014683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]