SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000015009 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000015009
Domain Number 1 Region: 404-612
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.24e-27
Family Extended AAA-ATPase domain 0.026
Further Details:      
 
Domain Number 2 Region: 1355-1470
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.55e-16
Family Shikimate kinase (AroK) 0.081
Further Details:      
 
Domain Number 3 Region: 632-846
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000234
Family Nitrogenase iron protein-like 0.092
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000015009
Domain Number - Region: 1829-1897
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0146
Family FCH domain 0.057
Further Details:      
 
Domain Number - Region: 1030-1117
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0266
Family G proteins 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000015009   Gene: ENSMEUG00000016367   Transcript: ENSMEUT00000016456
Sequence length 3057
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_9563:1578:87405:1 gene:ENSMEUG00000016367 transcript:ENSMEUT00000016456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFSVIKYFKGTQERGYILGSVDDIIQCLDDNTVNLQSISGSRFVGPFLTTVHKWEKTLS
LIGEVIEIWMVVQRKWMYLESIFIGGDIRSQLPDEAKKFDNIDRVFKRIMSETSKDPVIK
RCCEAPNRLTDLQNINDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPLCV
QEHMIKMYDNIASLRFQDGDSGEKLVTAMISAENEVMDFRKIVRAEGRVEDWMTSVLHEM
RRTNRLITKEAIFRYCEDRSRVEWMLLYQGMVVLVASQVWWTWEVEDVFRKVKQGEKQAM
KIFGQKMHQQIDELVTQITKRLSKNDRKKYNTVLIIDVHARDIVDSFIRGSILEAREFEW
ESQLRFYWDREPDELNVRQCTGTFGYGYEYMGLNGRLVITPTTDRIYLTLTQALSMYLGG
APAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYKAVGKIFSGLAQCGAWGCFDEFNR
IDASVLSVISSQIQTIRNALIHHLTTFQFEGQEISLDSRMGIFITMNPGYAGRTELPESV
KALFRPVVVIVPDLQQICEIMLFSEGFLLAKTLAKKMTVLYKLSREQLSKQHHYDFGLRA
LKSVLVMAGELKRGSSELKEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRV
RYPSFNDAVEQVLEENGYIVLPIQVDKVVQMYETMLTRHTTMVVGTRGGKTVVINTLCQA
QTKLGLVTKIYILNPKAMSVIELYGILDPTTRDWTDGVLSNIFRETNKPTDKKERKYILF
DGDVDALWVENMNSVMDDNKLLTLANGERIRLQAHCSLLFEVGDLQYASPATVSRCGMVY
VDPKNLKYEPFWMMWVNQINSKQEQKDLQHLFQKYVPYLIDMIVEGILDGRQGEKLKTIV
PQTDLNMVTQLTKMLDALLETEIEESDLLECYFLEALYCSLGASLLDDGRLKFDECVKRV
SSMSTVEDEEVWARPGELPGQLPTLYDFHFDGKQKRWLPWNRLVPEYIHNPEKKFIDILV
HTVDTTRTTWLLEQMVKIKHPVIFVGESGTSKTATTQNFLKNLNQDLNXXXXXXXSSRTT
SMDIQRNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPKXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXEAIAAVSDLMTSCTLQLYQDVQDFPPTPSKFHYIFNLRDLSRVFNGLVLTN
PERFQTVPQMVRVWRNECLRVFHDRLINEYDKTLVQDHIGLVQEHFAEDLEFVMRDPILF
GDFRMALHEGEPRIYEDIQDYEAAKALFQEIEEYNESNTKMNLVLFDDALEHLIRVHRII
RLDGGHALLVGVGGSGKQSLARLAAFTAGCEVFEIVLSRGYSESNFREDLKSLYIKLGIE
NKLMIFLFTDAHVAEEGFLELINNMLTSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLVNNTGIDWYLPWPPQALFAVAQ
SFLGENSMIPSDYTEDVVGHIVLVHESVGEYSKKFLQKLRRSNYVTPKNYLDFISTYSKL
LDEKTQFNIAQCKRLEGGLDKLKEATLQLDELNVKLAEQKIVLAEKSAACEALLEEISTN
TAIAEEKKKLAEEKAMEIEEQNKIIAVEKAEAETALEEAMPILEAAKLELQKLDKSDVTE
IRSFAKPPKQVQTVCECILIMKGYKELNWKTAKGMMSDPNFLRSLMEMDFDSVTQGQVKN
IRLLKNLNTTFEEMEAVSKAGLGMLKFVEAVMGYCDVFKEIKPKRDKVARLERNYFLSKR
ELERIQNELATLQAELEALGAKYEAAILEKQQLQEEAEIMERRLIAADKLISGLGSENVR
WLADLDELMHRRFKLLGDCLLCSAFLSYEGAFNWEFRNEMVNVVWQGDLLEREIPLSQPF
RLENLLTDDVEISRWGSQGLPPDELSVQNGILTTRASRFPLCIDPQQQALNWIKRKEEKN
NLRVASFNDPDFLKQLEMSIKYGTPFLFQDVDEYIDPVIDNVLEKNIKNVQGRQFIILGD
KEVDYDVNFKLYLNTKLANPKYSPSVFGKAMVINYTVTLKGLEDQLLSVIVAYERRELEE
QREHLIHETSENKNLLKDLEDSLLRELATSTGNMLDNVDLVQTLEETKTKAMEVSEKLKL
AEKTAVDIDRLRDGYRPAAKRGAILFFVLSEMALVNTMYQYSLSAFLDVFILSLKKSLPD
SFLPRRLKNIMDTLTFNIYNYGCTGLFERHKLLFSFNMTIKIEQADGRVPQEELDFFLKG
NISLEKSKQKKPCTWLADQGWEDIMLLSELFPDTFKRLPEDLEKQNDIWKEWYDLDSLEQ
FPFPLGYDSRVTDFEKLLILRCFRVDRVYRAVTDYVTVTMGEKYVQPPMISFEAIFEQST
PNSPIVFILSPGSDPASDLMKLADRCGFGGNRLKFLAMGQGQERXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWLTTDPTKGFPIGILQKSLKXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVMYGVRAIDSDRRIVTIYMDEYLGDFI
FDTFQTFHFFHNKEVDYKIPGGDTKEDFVDAIESLPLANTPEVFGLHSNAEIGYYTQAAR
DMWSHLLELQPQTGESGTGVSREDYIAQVAQDIENKMPKVFDLDSIRKHLGLSISPTTVV
LLQELERFNKLTIRMMKSLAELQRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXILESDPNVMWLSGLHIPESYLTALVQATCRKNGWPLDRST
LFTQVTKFQDADDVTERAGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXNTFRTPVYTTSMRRNAMGIGLVFEADLFTTRHISHWVLQGVCLTLNSD
Download sequence
Identical sequences ENSMEUP00000015009 ENSMEUP00000015009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]