SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000015014 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000015014
Domain Number 1 Region: 607-672,707-805
Classification Level Classification E-value
Superfamily PH domain-like 1.75e-32
Family Pleckstrin-homology domain (PH domain) 0.0056
Further Details:      
 
Domain Number 2 Region: 1223-1355
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000000366
Family Second domain of FERM 0.0055
Further Details:      
 
Domain Number 3 Region: 811-931
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000394
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 
Domain Number 4 Region: 1125-1204
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000426
Family First domain of FERM 0.087
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000015014
Domain Number - Region: 25-120,712-732
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00136
Family BAR domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000015014   Gene: ENSMEUG00000016407   Transcript: ENSMEUT00000016461
Sequence length 1486
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6031:290:74082:1 gene:ENSMEUG00000016407 transcript:ENSMEUT00000016461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEFLVQEGTVDWKERCIALESQLMKFRLQASKIRELLAEKMQQLERQVIDSDRRAERAF
QQVQAMEEKLKAANIQTSEAETRLYKKCQDLEILLQEKDDIIQNLELQLEEQKQIRIQEA
RIIEEKAAKIKEWVTVKLQELELENQNLRLINQSQTEEIGTIQTKLQEVQGKKLSTASPP
KPSEGQRLSSLTFGCFLSRAKSPQQVTKPEEVSKISSKEPEFPEGNHVEEMDIPETSLGS
QLQEHNKGQRSLQQNSCSLEQNGVTEASYTLQGVDGSKDTSKNSCVTVSDWSSDEEDESK
ERSKCRCDSTFSSHTSEESTRYSRMESEMYLTASDDSSSLFEEESFGIRRTEHKKLYSWQ
LEAQWKAQNSTSGKGSCESWSAIGKDGFSDELKKKFQCQILDYSSSSSEANTPSPILTPA
LAPKNPSLLPGRTSHSMPFHPSSNLSPAKLRIPNVFSISVALAKRHLSQPQLSSDRMFGR
NRNAISMIRPLKPQETDIDLVDGDSTEIVENMDVGYDERVFSYDSLEAPCSEDSEICDSA
AKKTAGGKPPTPPLHRFPSWXXXXXXXXXXXXXXXXXXXXXXXXXXSFLMSSYSTSGLYT
SLIYKDMTTPVYTTLKGKATQISNSPFLDDSSGSEEEDSSRSSSRASESDFRSRSRPGSP
RAMKRGVSLSSITSENDYAIPPDAYSTDSEPEQKLPKTCSSSSDNGKNEPLEKSGYLLKM
GGKVKTWKRRWFVLKGGELLYYKSPSDVIRKPQGHIELSMSSHIVRGDNKQTVQLTTEKR
TYYLTADSPNILEEWIKVLQNVLRVQAANPLFLQPDGKPTVKGLLTKVKHGYSKRVWCIL
IGKTLYYFRNQEDKXXXXXXXXXXXKVEEVDRSCDSDEDYESGGRSLLSTHYTIVIHPKD
QGPSYFLIGSKHEKDTWLYHLTVAAGSTNVNVGSEFEQLVCKLLNIEGEPXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXTCQLFINAAVDSPAIDYHISLAQSALQICLTH
PELQNEICCQLIKQTRRRQIQNQPGPLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XTEFGKYAIYCQRCVKRTQQNGNREARPSRMEILSTLLRNPYHHSLPFSIPVHFMNGIYQ
VVGFDTSTTVEEFLNTLNQETGMRKPAQSGFALFTDDPSSKDLEHCLQGNIKICDIISKW
EQTSKEQQPGKCEGTRTVRLTYKNRLYFSMQVHGESEREKLLLMYQTNDQIVNGLFPPNK
ELAVEMAALLAQVEIGDFERPFSTPAGQVTCQYKANQTLKQVIEKFYPKRYKNGCSEEQL
RQLCQRLSTRWMALRGHSAADMCIYLTVARKWSFFGAKLFLAKPVTPSTLGNTFIWLAVH
EDGISILEYNSMRLVVTYVYKSLMTFGGYHDDFMVVINSAHSKDKPTDKLLFTMAKPCYI
NNFHQQKAALHHLSAPALLSARKGGPKDVGSQPPLLNNRPTKPTLL
Download sequence
Identical sequences ENSMEUP00000015014 ENSMEUP00000015014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]