SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000015115 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000015115
Domain Number 1 Region: 155-252
Classification Level Classification E-value
Superfamily C-type lectin-like 1.37e-35
Family Link domain 0.00058
Further Details:      
 
Domain Number 2 Region: 265-346
Classification Level Classification E-value
Superfamily C-type lectin-like 4.19e-23
Family Link domain 0.0036
Further Details:      
 
Domain Number 3 Region: 39-149
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000174
Family V set domains (antibody variable domain-like) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000015115   Gene: ENSMEUG00000016535   Transcript: ENSMEUT00000016582
Sequence length 372
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_3977:7163:21993:-1 gene:ENSMEUG00000016535 transcript:ENSMEUT00000016582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PARQWASTWILLVFAASAWGQWGRKKIVHVLEDESGAVVVQTAPGKVVTHRGGTIVLPCR
YHYDISAHDEDEIRLKWTKVTDPLAFRDVFVAMGKERRAFGSYRGRTSLQEDGPGDASLI
IRNVTLQDYGRYECEVTNELEDDAGMVSLDLEGVIFPYHPRLGRYTLTYPEAQRACAEQD
GILASYEQLHAAWREGLDWCNAGWLQDGSVQYPVGQPREECGRREAPVGVRNYGYRHKED
ERYDAFCFTSNLQXXXXFLKPPQGEFSGAVRACAGSGAAVAKVGQLYAAWKLQLLDRCEA
GWLGDGSVRYPIVNPRARCGGQRPGVRNLGFPDKKHRLFGVYCYRAPGSPDPGAARWGWG
WRDPSAWRPLHV
Download sequence
Identical sequences ENSMEUP00000015115 ENSMEUP00000015115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]