SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000015133 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMEUP00000015133
Domain Number - Region: 43-126
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0711
Family IMD domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000015133   Gene: ENSMEUG00000016559   Transcript: ENSMEUT00000016604
Sequence length 216
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6009:1833:13145:-1 gene:ENSMEUG00000016559 transcript:ENSMEUT00000016604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTEEELDIFEKSISDFWNRFRNTAFNEPYSQVVGVRDTYKYSIETLTERLSTKIKEEDQM
IETFLEFRNQNMLIQEKQDNFSKLVDNIQDNEWEMEKLNIQNLKESLDKKKEIISTANKA
NKKLKMLHDLYKYHLGLEIRKIFGGKLQFTFSTDPKAPEKPFTFSLHTNERGYEISDSAS
HLECLAEFKEKIRKINNFSTFLANVRRAFIALACNE
Download sequence
Identical sequences ENSMEUP00000015133 ENSMEUP00000015133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]