SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000015189 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000015189
Domain Number 1 Region: 17-162
Classification Level Classification E-value
Superfamily PH domain-like 8.3e-57
Family Ran-binding domain 0.000000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000015189   Gene: ENSMEUG00000016620   Transcript: ENSMEUT00000016669
Sequence length 195
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_1495:30645:37753:1 gene:ENSMEUG00000016620 transcript:ENSMEUT00000016669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETHEEHDTSTENVDDSNHDPQFEPIVSLPEQEIKTLEEDEEELFKMRAKLFRFASENDLP
EWKERGTGDVKLLKHKEKGTIRLLMRRDKTLKICANHYITPLMELKPNAGSDRAWVWNTH
ADFADESPKPELLAIRFLNAENAQKFKAKFEECRNEIEEKEKKAGAGKENTDKVVEKFSE
LSVKEEKKEGAEKEQ
Download sequence
Identical sequences ENSMEUP00000015189 ENSMEUP00000015189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]