SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000015253 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000015253
Domain Number 1 Region: 200-307
Classification Level Classification E-value
Superfamily PH domain-like 1.68e-35
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 
Domain Number 2 Region: 327-442
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000724
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000015253   Gene: ENSMEUG00000016686   Transcript: ENSMEUT00000016738
Sequence length 547
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_8050:17384:87652:-1 gene:ENSMEUG00000016686 transcript:ENSMEUT00000016738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAAAAASAAPAGGGGGRGQRSGLLEVLVRDRWYKVLVNLNEDSLILSSEEGAGAYNGI
GSGGTTNGSFGRSSGGGARATAPGGGGGQSLNTSVPAVGGRTAFTDLPDQVPESIANQKR
GVKVLKQELGGLGISINGGKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXKYMREATPYVKKGSPVSEIGWETPPPESPRLGSTNSDSPS
PISLSFHRDKKCIPLKMCYVTRNMALNDPEDRHLEIHSPDAKHTVILRSKDSATAQAWFN
AIHANVSDLLTRVITEVKEQLGKSGIPGSREIRHLGWLAEKVPGENEKTWKPALVMLTEK
DLLIYESMPRIKEAWFSPVHTYPLLATRLVHSGPGKGSLQSGVDLSFATRTGTRQGIETH
LFRAETSRELSQWTRSIVQGCHNSAELITEITTSCTYKNQECRLTIHYEHGFSITTEPQE
GAFPKTIIQAPYEKLKMSSDDGIRMLYLDFGGKDGEIQLDLHSCPKPIVFIIHSFLSAKI
TRLGLVA
Download sequence
Identical sequences ENSMEUP00000015253 ENSMEUP00000015253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]