SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000000092 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000000092
Domain Number 1 Region: 41-512
Classification Level Classification E-value
Superfamily Sema domain 5.62e-115
Family Sema domain 0.000000563
Further Details:      
 
Domain Number 2 Region: 1072-1333
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.82e-64
Family Protein kinases, catalytic subunit 0.0000000265
Further Details:      
 
Domain Number 3 Region: 672-760
Classification Level Classification E-value
Superfamily E set domains 8.53e-16
Family Other IPT/TIG domains 0.043
Further Details:      
 
Domain Number 4 Region: 512-558
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000141
Family Plexin repeat 0.00097
Further Details:      
 
Domain Number 5 Region: 557-610
Classification Level Classification E-value
Superfamily E set domains 0.000000106
Family Other IPT/TIG domains 0.086
Further Details:      
 
Domain Number 6 Region: 759-796
Classification Level Classification E-value
Superfamily E set domains 0.00000126
Family E-set domains of sugar-utilizing enzymes 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000000092   Gene: ENSMEUG00000000094   Transcript: ENSMEUT00000000102
Sequence length 1348
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_7005:7523:39620:-1 gene:ENSMEUG00000000094 transcript:ENSMEUT00000000102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSFSFCLLLLLLAEGLPSLGKAWQCPGMPYAASRNFSVQYVVPSFEAAAPIQRVVAYDE
GEVIFVATRNHLHLLNAKLELLQGLVTGPAGLPSCHSCTACGGSEPSLPGADTDNAVLVL
DPVLPWLYSCGSSLMGRCFVHELEVDGGTVHLGPTTCLWSPSGNSPHDCPDCVASPLGTQ
VTVVGQGQSSYFYVASTLNQTVASHYSPRSVSIRRLKSNLQGFAPSFPALSVLPEYLATH
PIEYVYTFRSGSYVYFLTVQPESLKVPSTFHTRLVRLSASETDLGEYRELVLDCRFSSKR
RRRREDRRPYNVLQAAHVARVGPSLAVDLGVVQGEKVLFGAFAVSQEGSRVPRHKSAVCA
FPITKLDDFIDTGMERCCAPGQPGVWRGVEFFQPQSYCPDPPKTTPLGSNVSCWNYPTMI
PTNHPRVDLLNGHLDGILLTAIHVIHQGNATVAHMGTADGRILQVKLFRSLNYLLYVSNF
SLGSSQPVHRDVSRLGDHLXXXXXXXVFKVPIQGPGCRHFLTCNRCLRAERFMGCGWCGD
VCGWQEECPGTWQQASCPPHITEFHPKSGPTRGSTKLTLCGSNFHSHFQNLDSEGPQKVT
VGQSSCKVLPRATSYLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXQPVVTSIVPLFGPWAGGTQLTIKGQNLNVGSSRLVLINGTECRFGLMD
EPQRLLCSTPPGGAQGNVSISLYIGGSEIPTPWFFQYRNNPRIFSISPNCSYPGSRITIQ
GQNLDAIWQMTTTFEDGHTEAKNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFSGLSAVASCMDVNITVGGQSCQANL
KNNPVICYIPPNLPIPHRGVPLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXISLHIDPSGSRDRNHRAISLPLLQSGSDYRSSLALSPTEDL
TIQGASSTGNSSASGVPLLRVKSVCVGELSSELLAEVKDVLIPPEQIITHNDQVIGKGHF
GIVYHGEYMSTSQDRIHCAIKSLNRITEIEEVEEFLREGLLMRSFCHPHVLSLIGILLPP
EGLPLVVLPYMKHGDLRHFIRSPKRXXXXXXXXXXXXXXXXXXXYLAEKKFVHRDAARNC
MLDETFTVKVADFGLARDILDKEYYSVRKHRHARLPVKWMALESLQTYKFTTKSDVWSFG
VLLWELLTRGASPYPNIDPFDIAHFLAQGRRLPQPEYCPDALYQVMLQCWDPVPTKRPTF
GVLVREVECISASLRGEHYVNLPVYVNL
Download sequence
Identical sequences ENSMEUP00000000092 ENSMEUP00000000092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]