SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000000100 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000000100
Domain Number 1 Region: 175-455
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.22e-73
Family Nuclear receptor ligand-binding domain 0.00000000192
Further Details:      
 
Domain Number 2 Region: 125-202
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.46e-25
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000000100   Gene: ENSMEUG00000000109   Transcript: ENSMEUT00000000111
Sequence length 456
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_9431:23153:116814:-1 gene:ENSMEUG00000000109 transcript:ENSMEUT00000000111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVELCIPESFSLHYEEELLCRMSSKDRHIDSSCSSYIKTEPSSPASLTDSINHHSPGG
SSDASGSYSSTMNGHQNGLDSPPLYPSAPVLGGNGPVRKRYDDCSSTIAEDSQTKCEYML
NSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSC
QACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSH
LLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTSLADQMSLL
QSAWMEILILGVVYRSLFEDELVYAEDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLE
KEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLP
LLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
Download sequence
Identical sequences ENSMEUP00000000100 ENSMEUP00000000100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]