SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000000103 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000000103
Domain Number 1 Region: 318-433
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.29e-37
Family Nuclear receptor ligand-binding domain 0.00000282
Further Details:      
 
Domain Number 2 Region: 46-131
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-26
Family Nuclear receptor 0.00012
Further Details:      
 
Domain Number 3 Region: 151-268
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0000000000000359
Family Nuclear receptor ligand-binding domain 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000000103   Gene: ENSMEUG00000000113   Transcript: ENSMEUT00000000114
Sequence length 437
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_5479:12125:35252:1 gene:ENSMEUG00000000113 transcript:ENSMEUT00000000114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQGTGINLEERHRVGWSHVILLEGEKETVSGPSSNDPSTEEDDGEPKVCRVCGDRATGYH
FNVMTCEGCKGFFRRVVKRNVRLRCPFRKGTCVINQKTRKQCQACRLRKCLDSGMKKEMI
MSDAAVEQRRALIKRKKREQLETQTLEVKGLTEEQQKMILELLDAQKKTFDATFSHFKNF
LIPEVQNGDPEIPKSMSEEEAARLNRITKELCPISLRLQGEDGSIWNYSPLNDISGKMII
FFLPHMANTSTYVFKGIINFAKVLSCFRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXSLQHCLLAPVLKLHYMLKKLKLHDEEYVLMQAISLFSPDRPGVV
QHWVVDQLQQRFTMTLKAYIECKRPQPENRFLFLKIIAILTELRSINAQHTKQLLKIEDL
HSFATPLMRELFNIMDS
Download sequence
Identical sequences ENSMEUP00000000103 ENSMEUP00000000103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]