SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000000222 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000000222
Domain Number 1 Region: 33-517
Classification Level Classification E-value
Superfamily Sema domain 7.98e-101
Family Sema domain 0.00000863
Further Details:      
 
Domain Number 2 Region: 513-558
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000192
Family Plexin repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000000222   Gene: ENSMEUG00000000239   Transcript: ENSMEUT00000000244
Sequence length 870
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_7957:21043:32310:-1 gene:ENSMEUG00000000239 transcript:ENSMEUT00000000244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQILTLMLGAVQGLFPEEPQPLAVAPRDYLKQYPVFTGSGPSRYPPASSTEGLNIQRMLR
VNRTLFIGDXXXXXXXXXXXXXXXXXXXXXKLTWQSNPNDINICRMKGKQEGECRNFVKV
LLVRDDNTLFVCGSNAFNPICANYSMDTLEPMGDNISGMARCPYDPKHANVALFSXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPYFVHAVEWGSHVYFFFREIAMEF
NYLEKVVVSRVGRVCKNDVGGSPRVLEKQWTSFLKARLNCSVPGDSHFYFNVLQAATGIL
NLGGPPVILALFSTPSNSIPGSAVCAFDMGQVAAVFEGRFREQKSPESIWTPVPEELVPK
PRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHQLTRVAV
DTSAGPWGNQTVVFLGSDTGTVLKFLIQPNSSPRGPAEQSVFLEEFETYRPDRCFLPGVG
VAGQRLLSLEIDPTASALLVAFPRCVVRVPVARCQQHSGCMKNCIGSQDPYCGWTPDGSC
IFLAPGTRATFDQDISGGSTSGLGDCTGLLRESFMEERAGLVSVNLLVTSSVAAFVIGAV
VSGFSVCWFVGHRDRRELARRKDKEAILAHGGEGQVVSVSRLGEAWGDWAPSRPPETLLA
PLMQNGWPQAALLQAGQHELASGLLPTPEQTPLQQKRCPXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAPALRRTHTFNSGSGSSESRPGE
PHHTRRPRPLTDFARLLPYGPERTAPPVQR
Download sequence
Identical sequences ENSMEUP00000000222 ENSMEUP00000000222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]