SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000000357 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000000357
Domain Number 1 Region: 768-891
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000518
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 2 Region: 374-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000859
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 3 Region: 683-751
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000474
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 4 Region: 991-1075
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000312
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 5 Region: 286-411
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000392
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 1294-1334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000513
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 7 Region: 530-566
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000148
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 8 Region: 570-606
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000214
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 9 Region: 645-683
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000001
Family EGF-type module 0.045
Further Details:      
 
Domain Number 10 Region: 419-453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000111
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 607-648
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 12 Region: 895-940
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000128
Family Fibronectin type III 0.0045
Further Details:      
 
Domain Number 13 Region: 420-525
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000267
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000000357   Gene: ENSMEUG00000000370   Transcript: ENSMEUT00000000391
Sequence length 1360
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6784:7594:148122:1 gene:ENSMEUG00000000370 transcript:ENSMEUT00000000391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WTLLVALALGPGAPLADFYPFGSEAGDAVTPKQDDGGSGLLPISGPFPFFGAEHTGLYVN
NNGIISFLKEVSQFTPVAFPISKDRCVVAAFWADVDNRRAGEVYYRESQEQATLQRATED
IWRYFPELPDFSAKWVFVATWHQVTFFGGSSSSPVNTFQTVLITDGKLSFTIFNYESILW
TTGMHASSGGNLAGLGGIAAQAGFNAGDGKRYFNIPGSRTDDIVDVEMTTNVGIPGRWVF
RIDDAQVQVGGCSNTXXXXXXXXXXXXXXXXXXXXXXXXPSYTCSCLAGFTGKKCHLDVN
ECASHPCQNGGTCTHGINSFSCQCPPGFKGPTCGTVESPCDTKDCQNGGECQAGNGTAEC
VCQPGYAGENCEIDINECDSDPCMNGGKCVDLVANYTCLCSESFTGPHCELGGPRISSAC
LSNPCQNEATCLETEQGYLCECPDGYTGSDCAEKLPEDCGCRNGGRCLEGNVTICHCPPG
YFGLLCEFEVTTTPCNVNTQCPDGGYCMEYGGSYLCVCHTDYSTNHSLPSPCDSDPCLNG
GSCDVHDDSYTCECPRGFHGKHCEKVRPRLCSSGPCRNGGTCKESNGEYLCSCPYRFTGK
HCEIGKPDSCASGPCQNGGTCFHYIGKYKCDCPAGYSGRHCEIAPSPCFMSPCENGATCN
DLGKDYSCHCRTGYTGKRCQSEVDCGTPSSVKNTQVRFNSTKMGSLAEYKCEEGYVLSSG
NNPRVCRAHGLWSEPPHCDXXXECESQPCLNGGSCKDRIASFLCICGSGFTGPHCELEID
ECQSDPCKNGGTCKDLPAAFVCQCPDGFAGIHCEKEVDACDSGPCQHGGECENDGGSYLC
VCPEGFFGYHCEIVSDPCFSNPCGGRGYCLSSNGSHSCTCKVGYTGRNCAKELLPPTKLK
VERVEDSGVSISWHPPEDQAAKQMIDGYAVTYASFDGSYRRTDFVDRSHSAHQLXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPRPVEGFEITNVTASSITVQWALHKVKHS
TVNKVRVSIRHFGDQEDHAVELDSTTDKYTFWDLLPGERYIIHVATLSGLGTEDHPSESL
ATAPFHVWTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTELVDGRGRISAKFSSVPSKSVTVRSX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYRNCSINPCQNGGTCVSGMDSYSCDC
GPGFKGRHCELSCKKVPHPCTRLYSETKSFPVWEGGVCHY
Download sequence
Identical sequences ENSMEUP00000000357 ENSMEUP00000000357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]