SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000000393 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000000393
Domain Number 1 Region: 2859-3038
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.22e-34
Family Laminin G-like module 0.00000425
Further Details:      
 
Domain Number 2 Region: 2270-2450
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.74e-34
Family Laminin G-like module 0.00098
Further Details:      
 
Domain Number 3 Region: 2683-2849
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-32
Family Laminin G-like module 0.0000811
Further Details:      
 
Domain Number 4 Region: 848-901
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000053
Family Laminin-type module 0.0012
Further Details:      
 
Domain Number 5 Region: 798-850
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000112
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 6 Region: 2453-2556
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000078
Family Laminin G-like module 0.03
Further Details:      
 
Domain Number 7 Region: 741-792
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000163
Family Laminin-type module 0.0052
Further Details:      
 
Domain Number 8 Region: 1376-1427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Laminin-type module 0.0061
Further Details:      
 
Domain Number 9 Region: 901-947
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000053
Family Laminin-type module 0.0064
Further Details:      
 
Domain Number 10 Region: 1481-1520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000248
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1433-1483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000167
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 12 Region: 1043-1091
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000921
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 13 Region: 396-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000229
Family Laminin-type module 0.049
Further Details:      
 
Domain Number 14 Region: 703-743
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000243
Family EGF-type module 0.076
Further Details:      
 
Domain Number 15 Region: 76-156
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000538
Family APC10-like 0.08
Further Details:      
 
Domain Number 16 Region: 950-990
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000067
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000000393
Domain Number - Region: 1333-1358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00781
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000000393   Gene: ENSMEUG00000000373   Transcript: ENSMEUT00000000428
Sequence length 3042
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_1780:26886:149931:-1 gene:ENSMEUG00000000373 transcript:ENSMEUT00000000428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGKMLPALLLWSAGQCQQRGLFPAILNLASNAHISTNATCGEKGPEMFCKLVEHVPGRPV
KNAQCRICDRNSANPKERHPISNAIDGTNNWWQSPSIQNGREYHWVTITLDLRQVFQVAY
IIIKAANAPRPGNWILERSLDGIEFTPWQYYAISDTECLTRYNITPRLGPPTYKRDDEVI
CTSYYSRLVPLEHGEIHTSLINGRPSADDLSPKLLEFTSARYIRLRLQRIRTLNADLMTL
SHRDPKDLDPIVTRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXVSPYENNPCLPCICDPFGSLSSVCVKDDHQSDQLNG
NWPGQCQCREGYTGEKCDRCQFGYKGYPNCFHCNCSLAGSVNDDPCSEPCLCKXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVIDMSGWLVTDLSSSNNIQS
QQNQMDGPHQITINNTVAMQMLKSKYYWSAPIAYLGNKLTAFGGNLKYTVSYDIPMETVD
SDLMSHADVIIKGNGLTLSTRAEGLSLQPYEEYFNVVKLVPENFRDYNTKREIDRDQLMT
VLANVTHLLIRANYNTAKKALYRLDAVTLDTANPNVIDLVLATDAEYCECPQGYTGISCE
SCLPGYYRVGGILFGGICQPCECHGHATECDIHGACLACKHNTMGAHCDQCLPGFYGNPS
QGTSEDCQPCACPLTTTSNNFSPTCHLDDGDEVICDQCQPGYTGMWCERCADGYYGNPTV
PGESCVPCDCSGNVDPLEVGHCDTVTGECLKCIGNTEGPHCERCADGFYGDALIAKNCHA
CSCHGSSSFSSICHHETGLCDCKPNVIGQHCDQCLDGYYGLNTGLGCLPCNCSQLGSLSQ
SCSDEGQCHCVPGVAGQRCDRCAHGFYAYQDGSCTXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXACNCSSIGSTSQQCDLSTGQCPCRQEYGGQSCNECAVRF
RDYPECVSCDCEVSGENVFGLHCSECKMGTFALHDDNPLGCSPCFCFGMTPLCSELEGYV
RIPITLTPDQSILRVVSQSNLEGTIKGVYYQHPEVLLDAATARQHGIAEPFYWRLPDQFL
GDQLMAYGGKLKYTVAFYSSDGIGTYNLEPQILIKGGRTSKLVIYMNIPAPENGVRKEQE
VDMKENIWKYFNSVSEKSVTRSDFMSVLSNIDYILIKASYGQGLIQSRIANISVEGVQAE
EMHSNRQVAYLLENCDCPSGFAGLSCQDCAPGYHRAKLPEAGAREPRTLIAPCIPCHCNN
HTETCHPETGKCLNCRDNTAGHHCNVCAPGYYGKVLGFVDDCSLCACPRTNASFSPTCVL
EGDNDFRCNACSLGYEGQYCEKCSSGFYGNPVKVGGSCQSCDCDPNGSVHGLCNTTSGKC
ICKPGVTGRACDECEPRHILVESKCVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
RMLQKSQELAMFIEKLRTNIKAIVEEAAALDKTWSINQQLPNATLQNMQEDIASMLEVLQ
KRNLMQLHQNATTELKAAKNLLSRIQKNYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXETNRLLLIITTNLKELNDKKLHVLENQNLSSALIEKGKGLIAAIAALAKDA
TNATEKLELHRDELLLWSAKIRHHVDELVMQMSKRGALNLVYRAEDHAAELMRLADVLDR
GLTDVRDVSLNATSAVHAHSSIQSFIEGAEKLATEASVEPLVSNGKETLQRGAKLLREAS
NLDGKTKGVMFKMSDLKKKVNRFQERAHKLTKQLNDSLLMLGVMMPDXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQNEDSSFYFDGSGY
SIVEKTLRSTVTQIIMLFSTFSPNGLLLYLASNGTRDFLSIELVDGKVKLTVDLGSGPLA
LITDRRYNNGTWYKIAFQRNKKQGLLAVFDAYNTTSKETKQGESPGGSSDLNRLNKDPIY
VGGLPRTRVVRKGLTSRSYVGCIKSLEISRSTFDLLRNSYGVRKGCLLEPIRSISIFNNG
YVELPPKPLSVESELMATFATKNSSGIILAGLSKGRDKRSRRQAHVPFFSIVLIEGHLEV
HINPGDGMSTRKATLRSTTGTYSDGQEHSIVLIRNKXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLDFTSAISYEQVDMDSCLLS
EKPRPTVIYGGEAELQPEAHPLSSPEQCVADREPDYVLNALQFGLAAGSHLVLPFNQSAI
RKKLSVQLTIRTFALSGLIYYMAHQNQIDYATLQLHGGQLYFMFDLGKGRTKASHPAFLS
DGKWHTVKTEYIKRKGFITIDGQESTMVTTIGDGNTLDVEGKFYLGGLPFDYRAKNIGNI
TYGVPACIGEVMINGQQLDKSNPISASSVNKCYTVAQEGTFFEGSGFVALVKEGYKVRSD
VNITLEFRTTAMNGVLLGISSAKVDAIGIEMVNGKVSFHVNNGAGRITATYEPKPASSLC
DGKWHKLQAHKSKHRIVLIVDGNTIPAESPHTQSTSADTNNPIYVGGYPADTKQNCLSSR
TSFRGCMRKLTLIKGQQVESIDFSKGFDLRGVFPHSCPGNEL
Download sequence
Identical sequences ENSMEUP00000000393 ENSMEUP00000000393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]