SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000000718 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000000718
Domain Number 1 Region: 33-498
Classification Level Classification E-value
Superfamily Sema domain 4.58e-166
Family Sema domain 0.00000000101
Further Details:      
 
Domain Number 2 Region: 500-549
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000458
Family Plexin repeat 0.00098
Further Details:      
 
Domain Number 3 Region: 558-630
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000863
Family I set domains 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000000718   Gene: ENSMEUG00000000776   Transcript: ENSMEUT00000000778
Sequence length 832
Comment pep:novel scaffold:Meug_1.0:Scaffold58148:1443:9682:1 gene:ENSMEUG00000000776 transcript:ENSMEUT00000000778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPCLGIWLVASALLGLGYGDNAWWNPVPRKTVSYGELAAVVRRFSQVGIQDFLTLTLAE
SKGVLYVGAREALFALSLETLELQSSIIWEATVEKKAECIQKGKSNQTECFNFICFLQPY
NSSHLYTCGTYAFQPKCTYIDVLTFSLEPGELEDGKGKCPYDPAKGHTGLIVDGELYSAT
LNNFLGTEPVILRNLGPHYSMKNEYLYSWLNEPHFVGSAYVPESVGSPTGDDDKIYFFFS
ERAVEYNCYAEQVVARVARVCKGDMGGARTLQRKWTTFLKARLVCAAPDRQLYFNQLQAL
HTLREDNWLNTTFFGVFRARWGDVDLSAVCQYQLEDIQRVFEGPYKEYQQQAQKWGPYTD
PVPSPRPGSCINNWHRHHGYTSSLELPDNTLNFAKKHPLMEGQVGPRWGRPLLVKKDTNF
THLVADQVKGLDDVTYDVLFIGTEDGWLYKAVNLGAWVHVIEELQVFDKEPVESLVLSYD
KKLLFAGSRSQLTQLPLADCSKYRSCADCILSRDPYCAWSTNTSRCVPLHGHLKSPFIQD
VVNSNTGLCNFRSGKKVKITPKNITVVSGTDLVLPCRLSSNLAHARWTFGGRELPAEQPG
SLLYDVRLQALVVLAAQPRHAGAYHCFSEEQGARLAAEGYLVAVVAGPSVTLEARAPLEN
LGLVWLAVVALGALCLVLLLLVLSLRRRLREELEKGAKAAERTLVYPLELPKEPTSPAFR
PGTDTDEKLWDPVGYYYSDGSLKIVPGHARCQPGGGPPSPPPGIPGQPLPSPTRLHLGGG
RSSNANGYVRLQLGGDDRAGPVHPLPELADELRRKLQQRQPLPDSNPEESSV
Download sequence
Identical sequences ENSMEUP00000000718 ENSMEUP00000000718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]