SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000001023 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000001023
Domain Number 1 Region: 345-592
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.06e-62
Family Nuclear receptor ligand-binding domain 0.00000000221
Further Details:      
 
Domain Number 2 Region: 262-334
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-25
Family Nuclear receptor 0.0000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000001023   Gene: ENSMEUG00000001112   Transcript: ENSMEUT00000001113
Sequence length 594
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_3554:3494:9971:1 gene:ENSMEUG00000001112 transcript:ENSMEUT00000001113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCIPAQYGTSAQSPGPRDHFAIDPLIQSGFTKITMDLAGPEVPPTAPTALPSFSTFMDS
YTGEFDTFLYQLPGAAQPASSSSSSTSSSSSTSSSSATSPASSSFKFEDFQIYGCYPGSF
SNQLDETLSSSGSDYYGSPCSAPSPSTPGFQAPQLSPWDGSSFGPFSPNQTYDSLRAWTE
QLPKGRPQPPAFFSFSPPAAPSPTMSPSPLKLLPPQPAHRLGEGEGYGQTVFSPLAPGSP
HLDGPLSPAKARAGVPGGMEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYVCL
ANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEXXXXXXXXXXXXRLPSKPKQTLDSSPVNL
LTSLVRAHIDSVPSTAKLDYSKFQELALPQFGKEDPGDVQQFYDLLSGSMDVIRKWAEKI
PGFLDLPSADQDLLLESAFLELFILRLAYRSKPGEGKLIFCTGLVLHRLQCVRGFGDWID
SILAFSRSLHSMVIDVPAFSCLAALVIITDRHGLQEPRKVEELQNRIAGCLKEHVSSTSG
EPQPPICLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIVDKIFMDTLPF
Download sequence
Identical sequences ENSMEUP00000001023 ENSMEUP00000001023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]