SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000001111 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000001111
Domain Number 1 Region: 801-1083
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.17e-55
Family Protein kinases, catalytic subunit 0.0000299
Further Details:      
 
Domain Number 2 Region: 495-796
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.73e-44
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 3 Region: 364-472,502-527
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000138
Family SH2 domain 0.0061
Further Details:      
 
Domain Number 4 Region: 286-354
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000861
Family Third domain of FERM 0.025
Further Details:      
 
Domain Number 5 Region: 77-206
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000115
Family Second domain of FERM 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000001111   Gene: ENSMEUG00000001170   Transcript: ENSMEUT00000001207
Sequence length 1097
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_2086:9232:17390:-1 gene:ENSMEUG00000001170 transcript:ENSMEUT00000001207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITPLCYNLFALYDTQAQIWLPPNHLFEIMKDTNQTLQFRMRYYFRNWHGLSPQEPAVYRS
MPRGVEVSEEKTALGMCFLDRASFEYLYEQGKFEFVNDVASLSDLHSEAEIHHFKNESLG
MAVLHLSHLALQRGVPLDEVVRKTSFKDCIPRSFSRQIQQNNSLTKFRLRNVFQKFMRRF
HLQTVGPGRLSEQDIMFKYLATLEQLAPRFGTERFLALTLALATEAERDLCYVNSSEQGP
TVQEPAEQAPTHEVLVTGTSGIHWRLLQVEVSDPGGRARSQASPTERKEPWTYFCDFQDI
THVVVKENNVSIHRQDNKCLELTLASPMMALSLVSLVDGYFRLTADSSHYLCHEVAPPRL
VMSIQNGIHGPLQESYVLSKLKREEVEDGLYLIRWSSFDFHRLILTVARKDQAFGAQGLR
YKHFRIEERGLTFQLEGWDQAFSSVRELTAALQGCTLRSSSGCFTLSKCCLPRAGEISNL
IITRQRPKEGPKPLNLSQLSFHQIRKEEITQLAHLGQGTRTNIYEGLLHVGGGVGAEDEE
EDNFPSEPNNNHRDLRVVLKVLDPSHRDIALAFFETASLMSQVSHIHLAFVHGVCVRGSE
NIMVAEHVEHGPLDVCLRREKGHVPVAWKITVAQQLASALSYLEDKNLVHGNVCAKNILL
ARCGLGDGTQPFIKLSDPGVSVTALSREERVERIPWIAPECVPSGTGLSTAADKWSFGTT
LLEICFDGEAPLQGRTPSEKERFYEKRHRLPEPSCKELATLISQCLTYEANQRPSFRTIL
RDLTQLQPQNLIDITTVSLELPASDPTVFQKRYLKKIRDLGEGHFGKVSLYCYDPTNDGT
GEMVAVKSLKAGCSSQLLSSWQREIEILRTLYHEHIVKYKGCCSDQGEKMVQLIMEYVPL
GSLRDYLPKHSLGLAQILLFAQQICEQHYIHRDLAARNVLLENDNTVKIGDFGLAKAVPE
GHDYYCVQEDGDSPVFWYAMECLKECKFYYASDVWSFGVTLYELLTRCDCNQTPPLKFIE
MIGVTQGQMTVLRLIDLLERGQRLPCPKGCPNEXXXXXXXXXXXXXXXRPTFQNLVPLLR
KFHEKYRNQAPSVFSVC
Download sequence
Identical sequences ENSMEUP00000001111 ENSMEUP00000001111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]