SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000001607 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000001607
Domain Number 1 Region: 1064-1184
Classification Level Classification E-value
Superfamily PH domain-like 3.52e-25
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 2 Region: 1326-1423
Classification Level Classification E-value
Superfamily PH domain-like 8.05e-24
Family Pleckstrin-homology domain (PH domain) 0.00000646
Further Details:      
 
Domain Number 3 Region: 869-947,999-1064
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.17e-17
Family DBL homology domain (DH-domain) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000001607   Gene: ENSMEUG00000001745   Transcript: ENSMEUT00000001762
Sequence length 1427
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_8598:10792:124893:-1 gene:ENSMEUG00000001745 transcript:ENSMEUT00000001762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKKPPLAPKPKFLVGSKPAPPPVAPKPDVVVSNVLSTKTSKPAIAPKPKVPKCSLVPDTR
LSPSRKNFVSLEEHKQESSEHSDKRKCQNGDDKRTPYILPVYTSNTECILNCGNGDNSCV
KHIVLERLETLENLENINIEDPLSVPKAKCVIQKCDAHSEKVGNRNQVVLKASLLEEKLK
DVFLHPLSPTTSPLKHRPTNSLEMDRSCDASEQFNIEIVALSQPLSGFDEVLQTRNCHVK
FPEDGIQILETSQDCPEVSINGVCSSDGEAMENDQVSGVQFLEGESQKSEVEEVAVSGKP
LAPCSKNLPTPKPRVPRTARLMRQAYVDAPGDSNEERDISQEDSSSSIENRVKLNKITLP
HQVLGNHEPGEKEERGSKSELTSDSRNRKCTNGQDVAIDQSSVFPQTSHNVERVEDCPPT
GFSFHPEGNTVADGNVSPHVDRRASFIKCNKQSMSLPTQLKPTYNQHLPAPNSLHGSPSK
TDKDATISGESPIKVAPKKPQRHSLPAAGRLKKAASEELLENSSYSSYEARSSEGILDKS
CLRHLTAKEHGMSSSFDMPKLIKNSEKPVWKLPHPILPFPGNPESLKSSNLSSNSESFPS
LTKPRAKSLSAVDMDRCNKPCKDPQKKSSLKKLLNMKLSICFMKSDFQKFLSKGSQVGEM
APGRPSSREGRGIDNSQVDEKRNKPVKAHSAETYSPASHKKKKIYRSQVDLPNGPKAESL
DDQILSRETPSIPFISGASDCGPEYENICRYEETPEYENLPFTLAPGRTPGSEWQNPNTM
EDSDTNVYEMEDPYVTSSSQLQQAPRPLHSSSRSSHEDEGDPDLLLGDLPSDEEEAINSS
DEDASSDSSKGEPDSLEDKQGKGTGKRSKVYLIAKEIMSSEKVFVDVLKLLHIDFRDAVA
QASRQFGKPVIEDRILNQILYYLPQLYELNRDLLKELEERMLNXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSPRCANLAIKHYLLKPVQRIPQY
RLLLTXXXXXXXXXXXXXXXXXXALAVVIEVANHANDIMKQGDNFQKLMQIQYSLSGHHE
IVQPGRVFLKEGTLMKLSRKVMQPRMFFLFNDALLYTTPVQSGMYKLNNMLSLAGMKVRK
PTQEAYQNELKIESVERSFILSASSATERDEWLEAISQSIEEYAKKKITFCPSRSLDEXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXHQNSSKTGSPANHKSPSSLSSVLHSIPSGRKQKKIPAA
LKEVSANTEDSTMSGYLYRSKGSKKPWKHFWFVIKNKVLYTYAASEDVAALESQPLLGFT
VAEVHDENSQSKVFQLLHKNVLFYMFKADDAHSAQKWIEAFQEGTVL
Download sequence
Identical sequences ENSMEUP00000001607 ENSMEUP00000001607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]