SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000001612 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000001612
Domain Number 1 Region: 1-412
Classification Level Classification E-value
Superfamily Sema domain 1.67e-116
Family Sema domain 0.00000000305
Further Details:      
 
Domain Number 2 Region: 408-459
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000802
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 475-557
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000611
Family I set domains 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000001612   Gene: ENSMEUG00000001761   Transcript: ENSMEUT00000001768
Sequence length 651
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6140:1065:71804:-1 gene:ENSMEUG00000001761 transcript:ENSMEUT00000001768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TECANFIRVLQAYNRTHVYVCGTGAFHPICGYIDLGTHKEXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXEYLYAGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLHGAKFIG
TFPIPDTYNQDDDKIYFFFRESSQEGSTSDKTILSRVGRVCKNDVGGQRSLINKWTTFLK
ARLICSIPGNDGADTHFDELXXXXXXXXXXXXXXXXXXXXXXXXSIFKGSAVCVYSMADI
RAVFNGPYAHKESADHRWVQYDGRIPYPRPGTCPSRTYDPLIKSTRDFPDDVISFIKRHP
VMYKSVYPVAGGPTFTRINVDYRLTQIVVDHVIAEDGQYDVMFLGTXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXNPSLILNMEMSLKQQQLYIGSRDGLVQLSLHRCDTYGKACADCC
LARDPYCAWDGNACSRYAPTSRRARRQDVKYGDPITQCWDVEDSISHETADEKVIFGIEF
NSTFLECIPKSQQASIKWYIQRSGEEHREELKPDERVIKTEYGLLIRSLQKKDSGMYYCK
AQEHTFIHTIVKLTLNVIENEQMESTQKAEQEEGRGKDLLAESRLRYKDYMQILSSPNFS
LDQYCEQMWHREKRKQRNKGGAKWKHVQEMKKKRNRRHHRDPEQLSRAVAT
Download sequence
Identical sequences ENSMEUP00000001612 ENSMEUP00000001612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]