SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000001674 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000001674
Domain Number 1 Region: 6-163
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 1.2e-61
Family TRADD, N-terminal domain 0.00000164
Further Details:      
 
Domain Number 2 Region: 209-289
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000118
Family DEATH domain, DD 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000001674
Domain Number - Region: 173-184
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0549
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000001674   Gene: ENSMEUG00000001836   Transcript: ENSMEUT00000001837
Sequence length 290
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_3678:48706:53015:-1 gene:ENSMEUG00000001836 transcript:ENSMEUT00000001837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGLQEWSGSAYLFVESSMEKVILPNLYQDSQKKLAIFRVLKLALAGCTGSQDGVQILK
IHCNNPQLIVQLKFCGQEPCTRFLRSYREGALRAALQDSLVALLGHAQHPVPLHLELRVG
SERLDLMLQEEERCLRCIPGGPDRLRDEEIGELEDAFRSLTCDPGGGGAPKAPPPAPAHP
PPPPAPAQTFVFQGRQIANRPLNLEDRQKFARSVGRKWRTVGRALNCRALREHDLDSLAY
EYDRDGLYEQAFQLLHRFVLAEGHRATLQRLVEALDRSSLTSLAEELLGL
Download sequence
Identical sequences ENSMEUP00000001674 ENSMEUP00000001674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]