SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000001697 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000001697
Domain Number 1 Region: 340-472
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-41
Family C-type lectin domain 0.0000893
Further Details:      
 
Domain Number 2 Region: 199-334
Classification Level Classification E-value
Superfamily C-type lectin-like 2.28e-37
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 3 Region: 928-1075
Classification Level Classification E-value
Superfamily C-type lectin-like 1.01e-32
Family C-type lectin domain 0.0008
Further Details:      
 
Domain Number 4 Region: 790-918
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-32
Family C-type lectin domain 0.00051
Further Details:      
 
Domain Number 5 Region: 627-777
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-28
Family C-type lectin domain 0.00036
Further Details:      
 
Domain Number 6 Region: 1221-1356
Classification Level Classification E-value
Superfamily C-type lectin-like 1.3e-27
Family C-type lectin domain 0.0033
Further Details:      
 
Domain Number 7 Region: 2-136
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.28e-21
Family Cysteine rich domain 0.0028
Further Details:      
 
Domain Number 8 Region: 136-194
Classification Level Classification E-value
Superfamily Kringle-like 2e-20
Family Fibronectin type II module 0.00087
Further Details:      
 
Domain Number 9 Region: 482-618
Classification Level Classification E-value
Superfamily C-type lectin-like 7.59e-20
Family C-type lectin domain 0.0031
Further Details:      
 
Domain Number 10 Region: 1133-1208
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000000000245
Family C-type lectin domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000001697   Gene: ENSMEUG00000001834   Transcript: ENSMEUT00000001862
Sequence length 1429
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_198:12645:49169:1 gene:ENSMEUG00000001834 transcript:ENSMEUT00000001862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNVFLIFAHGLQGCLEAQEGQVKATSVCNTSLPAQQWKWVSRNRLFNLGTMQCLGLGTAW
PGANATMVPSLGTYECDREALSLRWYCQTLGDQLSLYLGGHTGNASKTVLSDRGDQTRGN
QWRIYGSDEDLCSVPYYEIYTIQGNSHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATT
QDYGKDERWGFCPIKSNDCETFWDKDQLTNSCYQFNFQSTLSWREAWASCEQQGADLLSI
TEIHEQTYINGLLTGYSSTLWIGLNDLDTNGGWQWSDNSPLKYLNWESDQPDNPSEENCG
VIRTESSGGWQNRDCSIALPYVCKKKPNATVETSLQPDSWTGVKVECEPSWRPFQSHCYR
LLQEKRSWHESKKACLRGGGDLLSIHSLAELEFITKQIKQEVEELWIGLNDLKLQMNFEW
SDGSLVQFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGQVSLGTA
EEDHGCRKGWTWHSPSCYWLGEDYVTYNEARRMCMDQGATLVTITNXXXXXXXXXXXXXX
XXXXXXXXXXDINGTGSFHWLSGDEVMYHWNRDQPGYSRGGCVALATGSAVGLWEVKNCT
TFRARYICRQNLGTPVTPELPGPDPTPSLTGSCPQGWASDLKLRHCYKVFSSEKIQDKKN
WLLAQSACQEMGAQLLSLASYEEEHFVSNMLNKIFGESEPEIQEQHWFWIGLNRRDPRAE
RSWRWSDGLGYSYHNFDRSRHDDDDIRSCAVLDLASLQWVAMQCETQLDWICKIPKGVDV
KEPDVSPQGRKEWIRFQEAEYKFFEHHSTWGQAQRICTWFQAELVSVHSQAELDFLGHSL
QKFSRGQEQHWWIGLHTSENDGRFRWTDKSIVNFISWAPGKPRPIGKDKKCVYVTASRED
WGDQRCLTALPYICKRSNNTDGKPPLDPSLSLLPGGCPTGWSQFINMCFRIQGHDPAERV
KWSEAQHMCEQQGAQLATIANPLEQAFITASLLNVTFDIWIGLHATQKEFQWVGQEPMLY
GNWAPGEPSGHSDSTSGDKPTNCVVIGHSSSPHFTGRWDDRNCLEETHGFICQRGTXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTSLAEVNPYTQAFTQAAR
SLHTPLWIGLSDEEGSRRYSWVLDELSYANWKDGEPQLPGGCGYLDVDGTWRTTSCDTKL
QGAVCGVRREFQLPRRVSHCPHALADSAWIPFREHCYSFHMELMLGHKEALQRCQKVGGT
ILSIMDEMENVFVWEHMQSTEGQSGGAWLGMNFNPKGGTLVWHDNTAVNYSNWGPPGLGP
SMLSHNSCYWIQSSSGLWRPGGCTNITMGVVCKLPQALQENPTALVVVVLAALALMGLLA
VAALLYKRRRNPDRGAFESARYSRSSSGPGEVAEKNILVSDMEMNEQQD
Download sequence
Identical sequences ENSMEUP00000001697 ENSMEUP00000001697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]