SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000001818 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000001818
Domain Number 1 Region: 106-305
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-52
Family Nuclear receptor ligand-binding domain 0.0000000586
Further Details:      
 
Domain Number 2 Region: 9-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.14e-26
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000001818   Gene: ENSMEUG00000001987   Transcript: ENSMEUT00000001991
Sequence length 308
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6501:9213:11703:-1 gene:ENSMEUG00000001987 transcript:ENSMEUT00000001991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANREDELRSCAVCGDRATGYHFHALTCEGCKGFFRRTVKKGMGLTCPFEQCCEVSKNQR
RHCPACRLQKCFDAGMRKDMILSAEVLAQRRAKQAQKKAEQEPVQLSQKQEALVQVLLGA
HARHVGTILFDQFVQFRPPAHLFIHNEPAGSLSPVLPLLIHLADISTFMVQQVIKFTKDL
PHFRSLPMEDQISLLKGAALEICHIELNTTFCPHSQTFLCGPLRYTYQDAVHVCPSVGFQ
EQFLELMFRFHVTLRRLQLQEPEYALMAALALFSPAPGPDRPGVTQREQIDQLQEEMALT
LQSYIGGQ
Download sequence
Identical sequences ENSMEUP00000001818 ENSMEUP00000001818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]