SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002430 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002430
Domain Number 1 Region: 1-157,187-249
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.62e-66
Family BAR domain 0.00049
Further Details:      
 
Domain Number 2 Region: 251-273,302-359
Classification Level Classification E-value
Superfamily SH3-domain 1.53e-17
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002430   Gene: ENSMEUG00000002660   Transcript: ENSMEUT00000002668
Sequence length 360
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_1469:891:24568:1 gene:ENSMEUG00000002660 transcript:ENSMEUT00000002668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTEEKLGQAEKTELDAHLENLLSKAECTKQWTEKIMKQTEVLLQPNPNARIEEFVYEKLD
RKAPSRINNEELLGQHMIDAGNEFGPGTAYGNALIKCGETQKRIGTAVRELIHTSAINFL
TPLRNFIEGDYKTIAKEKKLLQNKRLDLDAAKTRLKKARTAETRASQLNSTLPEGDNIMX
XXXXXXXSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQ
YMLDLQKQLGSFPSAFISNNNQASTASVSPLSSSPVTSSLLPSTSSTIVTPSLSDLKESS
GSRKARVLYDYDAANSSELSLLADEVITVYSIVGMDSDWLMGERGNQKGKVPITYLELLN
Download sequence
Identical sequences ENSMEUP00000002430 ENSMEUP00000002430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]