SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002804 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002804
Domain Number 1 Region: 95-198
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000108
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 2 Region: 505-565
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000393
Family Second domain of FERM 0.0084
Further Details:      
 
Domain Number 3 Region: 400-491
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000475
Family Ras-binding domain, RBD 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002804   Gene: ENSMEUG00000003073   Transcript: ENSMEUT00000003082
Sequence length 587
Comment pep:novel scaffold:Meug_1.0:Scaffold95787:861:7751:1 gene:ENSMEUG00000003073 transcript:ENSMEUT00000003082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPGGLWWLLCCRRGFTLLRRDYGDGELGGDADEDEDEETFELRTPGSVSCGRGPLEVT
LTQPGRSGPGSDRLQGSEETRSLIPERGPPEEESDIIVKGWLQREPRGGGARPWLPPRRA
WFVLTRDSLDQFSGSGRGARRLGSLVLTSLCSVSGPERKPKETGLWSVTVSGRKHSVRLC
SSRLAEAARWGAALRSVIAGKAPLETPTQLLLRDIQESGGDSEAVALIYRRNPILRHTSS
ALYAPLLPLPYGIGPPGPGYAPLREEAVRLFLALQALEGARRPGPLMQGVLQTCQDLPAL
RDELFLQLAKQTSGPAGPPESPAPNNPAALRYWQLLCCMSCTFRPGGAVRGHLLGHLERT
EKAFPDTELAEYTRFIRKALGRTRGRELVPSLAEISALSQRQELLCTVHCPGAGACSVAI
DSHTTASEVARELVGRLGLARSRNAFALYEQRGSQERALAGGALVADVLTRFENLPAEEA
ESPESGWRLCLRLHGPLHPEGLPPDGHELPFLFEQAHALLLRGRPPPPEDTLRALAALRL
QSLHRDFSPLAPLPRLDRLLPTSVLTRETPPRPAPRAPRTAALLAGA
Download sequence
Identical sequences ENSMEUP00000002804 ENSMEUP00000002804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]