SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002823 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002823
Domain Number 1 Region: 815-869
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000271
Family Laminin-type module 0.0000857
Further Details:      
 
Domain Number 2 Region: 711-762
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000114
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 3 Region: 274-332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000391
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 4 Region: 922-972
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000949
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 5 Region: 871-919
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000159
Family Laminin-type module 0.00035
Further Details:      
 
Domain Number 6 Region: 760-817
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000614
Family Laminin-type module 0.00023
Further Details:      
 
Domain Number 7 Region: 330-388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000173
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 8 Region: 386-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 9 Region: 970-1015
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000151
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000002823
Domain Number - Region: 1276-1513
Classification Level Classification E-value
Superfamily Tropomyosin 0.00275
Family Tropomyosin 0.0013
Further Details:      
 
Domain Number - Region: 89-166
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00319
Family Galactose-binding domain 0.045
Further Details:      
 
Domain Number - Region: 457-485
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00446
Family Laminin-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002823   Gene: ENSMEUG00000003083   Transcript: ENSMEUT00000003101
Sequence length 1596
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4533:2852:76079:1 gene:ENSMEUG00000003083 transcript:ENSMEUT00000003101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSPTRPLAALLAAAAAGWAAAAMDECADEGGRPQRCMPEFVNAAFNVTVVATNTCGAP
PEEYCVQTGVTGVTKSCHLCDAGQPHLAHGAAYLTDYNNQADTTWWQSQTMLAGVQYPST
INLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTQEDGPWIPYQYYSGSCENTYLKPNRG
FIRTGGDEQQALCTEEFSDISPLTGGNVAFSTLEGRPSAYNFDYSPVLQXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCKCNGHASECVKNNFDKLVCNCKHNTY
GVDCEKCLPFFNDRPWRRATAESASECLPCNCNGRSQECYFDPELYRSTGHGGHCTNCQG
NTDGANCERCRENFYRLGNEEACLPCHCSPVGSLSTQCDNYGRCSCKPGVMGDKCDQCQP
GFHSLTEAGCXXXXXXXXXXXXXXXXXXXXXXXXXXXXGFNCERCKPGFFHLESSNPRGC
TPCFCFGHSSVCTNAEGYSIHFITSTFQIDEEGWRAEQRDGSETSLQWSSESQEVSVISD
SYFPIYFIAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLEGAGLRVSVPLIAQG
NSYPSETTMKYVFRLHEATDYPWRPTLTPFEFQKLLNNLTSIKIRGTYSERSAGYLDDVT
LMSAQRGPGVPAVWVESCCPVGYGGQFCQLCISGYKRETPSLGPYSPCVLCTCSGHSETC
DPETGVCNCRDNTAGPHCEKCADGYYGDSTAGTSSDCQPCPCPGGSSCAVVPKTKEVVCT
NCPTGTTGKRCELCDDGYFGDPLGENGPTRLCRPCQCSDNIDPNAVGNCNRLTGECLKCI
YNTAGFYCDRCKDGYFGNPLASNPVDKCKACSCNPYGTVNQQTTCNQVTGQCECLPHVTE
RDCSACDPGFYNLQSGRGCERCNCHALGSTNGQCDIRTGQCECQPGITGQRCEQCEPNHF
GFGPEGCKPCDCHPEGSLSLQCKDDGRCECKEGFVGNRCDQCEENYFYNRSWPGCQECPA
CYRLVKDKVAEHRVKLQELENLIANLGTGDEAVTDQAFEDRLKAAEREVMDLLREAQDIK
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXSVTQPDSTGDPNNMTLLAEEARTLAERHKKEADDIVRVAKTANDTSTEAYN
LLLRTLAGENQTANEIEELNRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXNAANKIKKEAEALEQMMDKKLRDYEDLREDMKGKELEVKDLLDKGKMEQQ
TADQLLARADAAKALAEEAAKKGKNTLQEANDILNNLKDFDRRVNDNKTAAEEALKKIPA
INQTIAEANEKTREAQLALGSAAADATEAKTKAHEAEKMAGAVQKNATSAKAEAERTFAD
VTSLDKEVDEMLKQLQEAEKELKKKQDDADQDMMMAGMASQAAQEAEINARKAKNSVSNL
LTIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKEEMKIRDLDRKVSDLENEARKQEAAIV
DYNRDIEEIMKDIRNLEDIKKSLPAGCFNTPSIEKP
Download sequence
Identical sequences ENSMEUP00000002823 ENSMEUP00000002823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]