SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002917 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002917
Domain Number 1 Region: 22-252
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-70
Family Nuclear receptor ligand-binding domain 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002917   Gene: ENSMEUG00000003204   Transcript: ENSMEUT00000003206
Sequence length 268
Comment pep:novel scaffold:Meug_1.0:Scaffold86989:445:6379:1 gene:ENSMEUG00000003204 transcript:ENSMEUT00000003206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMG
IENICELAARLLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAP
LLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGL
SDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVG
KTPIETLIRDMLLSGSSFNWPYMSIQCS
Download sequence
Identical sequences ENSMEUP00000002917 ENSMEUP00000002917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]