SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000004396 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000004396
Domain Number 1 Region: 582-807
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.2e-75
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000999
Further Details:      
 
Domain Number 2 Region: 180-315
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-34
Family Third domain of FERM 0.00017
Further Details:      
 
Domain Number 3 Region: 67-150
Classification Level Classification E-value
Superfamily Second domain of FERM 8.5e-27
Family Second domain of FERM 0.00017
Further Details:      
 
Domain Number 4 Region: 2-65
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-17
Family First domain of FERM 0.0017
Further Details:      
 
Domain Number 5 Region: 512-558
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000469
Family PDZ domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000004396   Gene: ENSMEUG00000004796   Transcript: ENSMEUT00000004825
Sequence length 879
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_1272:1091:74993:1 gene:ENSMEUG00000004796 transcript:ENSMEUT00000004825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KHDQGQVLLDTVFKHLDLTERDYFGLQLADDSADNPRWLDPNKPIRKQLKRGSPYSLNLR
VKFFVSDPNKLQEEYTRYQYFLQIKQDILTGRLPCPYNTAALLASFAIQSELGDYDHSEN
LPGYLSDYSFIPGQPQDFEKEIAKLHQQHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXD
QSNNEIMIGVMSGGILIYKNRVRMNTFPWLKIVKISFKCKQFFIQLRKELHESRETLLGF
NMVNYRACKNLWKACVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGK
EKANKDRVFARSPSKPLARKLMDWEVVSRNSLSDERLETQSLPSRSPPGTPNXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXADLCVPRLNEGDQVVLINGRDIAEHTHDQVVMFI
KASCERHSGELVLLVRPNAVYDVVEEKFENEPDFQYIPEKSPLDGVHQNDNALRESMIQL
AEGLDSGTVLTQFDQLYRKKPGMTMSYAKLPQNISKNRYRDISPYDATRVILKGNDDYIN
ANYINMEIPSSSIINQYIACQGPLPNTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQY
WPELTESSLYGNFQVTCHSEERNSAYVFRNMTLCNLAENESRQLTQIQYVAWPDHGVPDD
SSDFLDFVCHVRNERAGKEEPVIVHCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXSQYRFVCEAILKVYEEGFIKPLKTLHK
Download sequence
Identical sequences ENSMEUP00000004396 ENSMEUP00000004396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]