SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000004533 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000004533
Domain Number 1 Region: 107-556
Classification Level Classification E-value
Superfamily Sema domain 1.96e-143
Family Sema domain 0.0000000951
Further Details:      
 
Domain Number 2 Region: 847-904
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000392
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 3 Region: 661-711
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000994
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 4 Region: 903-961
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000301
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 
Domain Number 5 Region: 552-604
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000314
Family Plexin repeat 0.004
Further Details:      
 
Domain Number 6 Region: 715-767
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000262
Family TSP-1 type 1 repeat 0.00086
Further Details:      
 
Domain Number 7 Region: 606-658
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000222
Family TSP-1 type 1 repeat 0.00096
Further Details:      
 
Domain Number 8 Region: 961-1006
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000549
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000004533   Gene: ENSMEUG00000004944   Transcript: ENSMEUT00000004973
Sequence length 1150
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_1148:5311:68027:-1 gene:ENSMEUG00000004944 transcript:ENSMEUT00000004973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRCGFISLPAAQLILGFDLAAIKPRHEWTVRCLLHQIRXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLKPWVSNFTYPGV
QDFSQLALDPSRNQLIVGARNFLFRLSLTNVSLLQATEWSSNEETRKSCQSKGKTEEECQ
NYVRVLIVSGRKVFTCGTNAFSPVCSSRQAGNLSRTIEKINGVARCPYDPRHNSTAVISE
QGELYAATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPNFVAAYDIGLFAYFFLRE
NAVEHDCGRTVYSRVARVCKNDVGGRFLLEDTWTTFMKARLNCSRPGEIPFYYNELQSAF
HLPEQDLVYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFRYQENPRAAWLPIANPIPNF
QCGTLRDVGPNENLTERSLQDAQRLFLMSEVVQPVTPDPCITQDSVRFSHLVVDLVQGKD
TLYHVLYIGTESGTVLKALSTASRSLRGCYLEELQVLPPGRREPLRSLRILHSARVLFVG
LNDGVLRIPLERCSAYHTQGECLGARDPYCGWDGKQQRCSTLEDSANMSLWIQNITTCPV
RNLTWDGGFGPWSPWQPCDHVDGDNSGSCQCRARACDSPPPRCGGRACPGPTIHVANCSR
NGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENSPCPVPI
FWATWGSWSKCSSNCGGGVHSRHRTCENGNSCPGCGVEYKTCNPESCPEVRRNTPWTPWL
PVNVTQGGARQEQRFRFTCRAPLPDPHGLQFGRKRTETRSCPADGSGACNTDALVEDLLR
SGNNAPHVVSGGWAAWGTWSSCSRDCELGFRTRKRTCTNPEPRNGGLPCVGDVTEYQDCN
SQPCPVRGAWSCWTPWSSCSASCGGGHYQRTRSCTSPAPSPGEDICIGLHTEEALCATQS
CPGGWSLWAEWSVCGEDGTQSRSRHCEELDPGTTPCLGNSSQIRTCPYSEIPVILPASSI
EDTTSCGGFSLIHLVATGVSCFLGSGLLTFAVYLSCQRCQRQTQESTLVHPTTPNHLNYK
SGGGGTPKNEKYTPMEFKTLNKNNLIPDDRANFYPLQQTNVYTTTYYPSSLGKHSFRPEA
SPGQRCFTNS
Download sequence
Identical sequences ENSMEUP00000004533 ENSMEUP00000004533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]