SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000004862 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000004862
Domain Number 1 Region: 55-522
Classification Level Classification E-value
Superfamily Sema domain 3.66e-138
Family Sema domain 0.000000158
Further Details:      
 
Domain Number 2 Region: 518-544
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000418
Family Plexin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000004862   Gene: ENSMEUG00000005309   Transcript: ENSMEUT00000005332
Sequence length 960
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_5331:132:10260:-1 gene:ENSMEUG00000005309 transcript:ENSMEUT00000005332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRGPPFTSLLLLLSLLSSSPRTQATFPQDPLPLVTSDLQGVSPLSWFRGLEGDAVAGEL
GLDFQRFLILNQTLLVAARDHVFSFDLQAQPWEGLVPDKYLTWRSQDVENCAVRGKLRDE
CYNYIRVLVPRDSRTLLACGTNSFSPMCRSYGISSLQQEGEELSGQARCPFDATQSSVAI
FAEGSLYSATAADFQASDAVVYRSFGPQPPLRSAKYDSKWLREPHFVHAVEHRDHVYFFF
REVSVEDARLGRVQFSRVARVCKRDVGGSPRALDRHWTSFLKLRLNCSVPGDSAFYFDVL
QALTGPVPLHGRPALFGVFTTQTNSIPGSAVCAFYLDDIEHGFEGKFKEQRSPDGAWTPV
PEDRVPSPRPGSCAGVGRAASFPSSRDLPDEVLTFIKAHPLLDPAVPPATHRPLLTRTGR
ALLTQVAVDGGAGRYGNTTVLFLGTEDGTVLKVLPPGGGYGNAEPILLEEIDTYSSSRCG
GKRSPQLARRVLGLVLDPDGHRLFVAFSGCVVHMPLSRCTQHGACQRSCLDSQDPYCGWG
SFKGCMDVRGPAWTDLEWDGDREIMEEGDCHDGAAGSHSPGDSAYXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALGASISGFLVSCAC
RHAYGHQGKDVETAGLPRPLSLRSLARLHGGGPDPPPPAKDGDSPPVPQLYTTFLPPTEG
MPAPELGCLPTPESTPELPVKQLQPVQGPWEWNHNGNNAKDTSAHSRSGSGPAPRVLVRP
PPPGCPGQAVEVTTLEELLRYLHAPQPPRKGTETPLPLATRVQPRVPPPEPAHALFSLVS
TPQDCIPPLRLDIPPDGKCPAPSRPPLSAPAPRLGIGGTRGISPSPHRVPPGLLTRVPSA
GTSRYSGGHGRYPLYLGRPEGYRGRALKRVDVEKPQLPPKAPLLVTSPSQEAPPDGHFNY
Download sequence
Identical sequences ENSMEUP00000004862 ENSMEUP00000004862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]