SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000004921 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000004921
Domain Number 1 Region: 140-418
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-77
Family Nuclear receptor ligand-binding domain 0.00000000122
Further Details:      
 
Domain Number 2 Region: 87-171
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-32
Family Nuclear receptor 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000004921   Gene: ENSMEUG00000005385   Transcript: ENSMEUT00000005398
Sequence length 454
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_5013:19256:36014:-1 gene:ENSMEUG00000005385 transcript:ENSMEUT00000005398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAANKDRLFVPSALGPGAGFPGTTSFPFTFSGGLRGSPPFEMLSPGFRGLGQPDLPKEMA
SLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQ
KNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGPPDS
YELSPQLEELIAKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCII
KIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQM
HNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLE
ALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENP
EMFEDDSSQPGPRPEPPSEDEGIGGGGDGDQPRP
Download sequence
Identical sequences ENSMEUP00000004921 ENSMEUP00000004921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]