SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000005059 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000005059
Domain Number 1 Region: 22-485
Classification Level Classification E-value
Superfamily Sema domain 1.83e-125
Family Sema domain 0.0000363
Further Details:      
 
Domain Number 2 Region: 1312-1440,1635-1824
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.2e-44
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 3 Region: 909-1002
Classification Level Classification E-value
Superfamily E set domains 0.000000000000196
Family Other IPT/TIG domains 0.041
Further Details:      
 
Domain Number 4 Region: 1000-1089
Classification Level Classification E-value
Superfamily E set domains 0.00000000000171
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.065
Further Details:      
 
Domain Number 5 Region: 483-529
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000144
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 821-910
Classification Level Classification E-value
Superfamily E set domains 0.000000000202
Family Other IPT/TIG domains 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000005059
Domain Number - Region: 1133-1194
Classification Level Classification E-value
Superfamily E set domains 0.0021
Family E-set domains of sugar-utilizing enzymes 0.075
Further Details:      
 
Domain Number - Region: 787-815
Classification Level Classification E-value
Superfamily Plexin repeat 0.0085
Family Plexin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000005059   Gene: ENSMEUG00000005507   Transcript: ENSMEUT00000005551
Sequence length 1854
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4053:17012:44008:1 gene:ENSMEUG00000005507 transcript:ENSMEUT00000005551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSALMLLLFHSPQGTICCGPFHTFSAADTTLTHLAVHRGTGEVFVGAVNRVFKLSPNLTE
LRAHITGPIEDNARCYPPPSMRVCTHHLVPTDNINKLLLIDYASRRLVACGSIWQGICQF
LRLDDLFKLGEPHHRKEHYLSGAQEPDTMAGVIVEQGSEPSKLFIGTAIDGKSEYFPTLS
SRKLIRDEDSADMFSLVYQDEFVSSQIKIPSDTLSLYPAFDIYYVYGFGSESFVYFLTLQ
LDTQQTLLDAAGEKFFTSKIVRMCAGDSEFYSYVEFPIGCSRDGVEFRLVQSAHLAKPGP
RLAQTLGVSEDEDVLFTIFSQGQKNRASPPRQTLLCLFTLRDINAHIRRRIQSCYRGEGK
LSLPWLLNKELPCINTPMQINGNFCGLVLNQPLGGLQVIEGLPLLEDRSDGMASVAAYTY
RQHSVVFIGTRNGNLKKVRVDGIHDARLYETVPVAEGRPILRDLLFSPDHQYIYLLSDKV
SQVPVETCEQYLHCGACLGSGDPHCGWCVLHNKCCREGECPRAWEPHRFTEVLSECVRVS
VQPSNVSVTVPEVQQVTLLVQNVPDLTGGVSCSFEAMAENEASLLAPGQLQCLSPSLRDI
PAITSGRGATSTVQLYLHSKETGLKFAQADFVFYNCSTFQSXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXYSYEGDAQGAVALDFSVVWDGDFYIDKPDNFQAL
LYKCWAQRESCGLCLKADPRFECGWCISEKKCQLRAHXXXXIYPVKGPKEGGTQVTVLGE
NLGVTYHEVGVRVAGVRCNSIPAAYISAERIVCEMEESLVPSPLPGPVELCVGDCSADYR
TQSEQLYTFVTPTFDQVSPTQGPASGGTHLTIFGSHLDAGSSVAVAVRHRECQFVRRSAK
EILCISPSSGLGSGLGPGQAAITVRIDRANISSPAVLYTYTQDPTITLLEPAWSIFNGST
TITVTGTHLLTVQEPRVRAKYRGIETINTCRVLNDTIMLCKGPGIFYGQPHLQGEHPDEV
GFLMDHGAGYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKNLIPVASG
SSRLNYTVLIGGQPCALTVSDTQLLCDSPTQTGKQPVMILVGGLEFWPGTLHIYAERALT
LPAMAGLGAGGGLLLLAIGAVLIAYKRKTRDADRTLKRLQLQMDNLESRVALECKEAFAE
LQTDINELTNNMDGVKIPFLDYKTYAMRVLFPGIEEHPVLKELDTPPNMEKALHLFGQLL
HSRAFVLTFIHTLEAQRSFSMRDRGNVASLTMVALQGRMDYATGLLKQLLADLIEKNLES
KNHPKLLLRXXXXXXXXXXTNWFTFLLHRFLKECAGEPLFMLFCAIKQQMEKGPIDAITG
EARYSLSEDKLIRQQIDYKMLTLHCVCPESEGNVEVPVKVLNCDTITQAKDKLLDTVYKG
IPYSQRPKADDMDLEWRQGRVTRIILQDEDVTTKIECDWKRLNSLAHYQVTDGSSVALVP
KQVSAYNIANSFTFTRSLSRYESLLRTSSSPDSLRSRAPMITPDQETGTKLWHLVKNHDH
ADHREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETVFSTAHRGSALPLAIKYMFDFL
DEQADRQQIADPDVRHTWKSNCLPLRFWVNVLKNPQFVFDIHKNSITDACLSVVAQTFMD
SCSTSEHRLGKDSPSNKLLYAKDIPNYKTWVERYYRDISKMASISDQDMDAYLVEQSRLH
ANDFNTLSALSELYFYINKYREEILTALDRDVGCRKQKLRLKLEQVISLVSSNS
Download sequence
Identical sequences ENSMEUP00000005059 ENSMEUP00000005059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]