SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000005446 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000005446
Domain Number 1 Region: 129-259
Classification Level Classification E-value
Superfamily E set domains 6.07e-50
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000037
Further Details:      
 
Domain Number 2 Region: 1-134
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.11e-46
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000005446   Gene: ENSMEUG00000005955   Transcript: ENSMEUT00000005977
Sequence length 464
Comment pep:novel scaffold:Meug_1.0:Scaffold78846:1669:12032:-1 gene:ENSMEUG00000005955 transcript:ENSMEUT00000005977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIGYTGPGTVRISLVTKEPPHRPHPHELVGKDCRDGFYEAELCPDHCIHSFQNLGIQCVK
KRDLEQAIAHRMQTNNNPFNVPLEEQRGDYDLNAVRLCFQVTIRDPAGRPLVLPPVLSHP
IYDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVCFTGPGWEARGSFSQA
DVHRQVAIVFRTPPYAEPTLQAPVRVHMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKR
KRTLGTFKNIMKTSPFSGNSDTWTPPRRIAVPSRSSTASAPKPPVSQPYTFPPSLSTINL
EEFSPMVFSSGQVPAPSLAPAPTPAPSLVPAPPTTAPAPVPPQLSQSGEGTLSEALLGLQ
FDTDGDLAELLGDLTVPTNLAAIDNSEFQQLLNQGMAAPPSGEPMLMEYPESITRLMTGP
QRPHEPTPAPPGASALSNGLVGADEVFPSMGDMDLSAFLSQISS
Download sequence
Identical sequences ENSMEUP00000005446 ENSMEUP00000005446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]