SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000005662 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000005662
Domain Number 1 Region: 27-452
Classification Level Classification E-value
Superfamily Sema domain 1.12e-106
Family Sema domain 0.00012
Further Details:      
 
Domain Number 2 Region: 815-910
Classification Level Classification E-value
Superfamily E set domains 0.000000000000014
Family Other IPT/TIG domains 0.019
Further Details:      
 
Domain Number 3 Region: 1345-1471
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000000000000204
Family p120GAP domain-like 0.02
Further Details:      
 
Domain Number 4 Region: 455-503
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000196
Family Plexin repeat 0.001
Further Details:      
 
Domain Number 5 Region: 907-996
Classification Level Classification E-value
Superfamily E set domains 0.0000000000154
Family Other IPT/TIG domains 0.027
Further Details:      
 
Domain Number 6 Region: 996-1039,1071-1124
Classification Level Classification E-value
Superfamily E set domains 0.0000000296
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.078
Further Details:      
 
Domain Number 7 Region: 1724-1796
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000235
Family p120GAP domain-like 0.039
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000005662
Domain Number - Region: 613-643
Classification Level Classification E-value
Superfamily Plexin repeat 0.00196
Family Plexin repeat 0.0067
Further Details:      
 
Domain Number - Region: 1138-1192
Classification Level Classification E-value
Superfamily E set domains 0.0542
Family E-set domains of sugar-utilizing enzymes 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000005662   Gene: ENSMEUG00000006161   Transcript: ENSMEUT00000006214
Sequence length 1879
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_9716:622:35568:1 gene:ENSMEUG00000006161 transcript:ENSMEUT00000006214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPKMAGLLPIFFLLLLPLSSWKLPLHHFSVPNTTFNHLAMDADTGMLYVGAVNHLYQLTP
DLQQIGEAVTGPIWDSPDCLPFRDPTECPQARPTDNANQLLLVSGRARELVACGQVRQGV
CEKRSLKNVAQLIFRAEDPGDGQFVAANAPGVATVGLVVSTPGRDLLYVARGLAGKLSAG
VPPLTVRQLAGPQAFSSEGLGRLVVGDFSDYNNSYVGAFAGTQFAYFIFRRRGSRTQADY
RSYVARVCLNDANLYSYVEMPLVCQGHSLVQAAYLAPGQGGGTLLVVASPGPIGGSALCA
FPLREVHGRMEQARRLCYTEGGQGPNGEEVTIEYGVTSRCVFLPSDSPDSYPCGDEHTPS
PIASHQPLEAEPLHQHPLSAVAALEEAGHTIVFLGDTQGQLHKVFLNGSTGQLYSSLPVG
PPGTAVSPDLLLDRNGSHLYVMTTSQVNKVPISACQHFTDCPSCLQAQDPFCGWCVLQGR
CVRKEECTGFEQKHQWLWSYGPPEGSLCLAIQSLVPSQQPRQEQGQVTMVVPQLPALAPD
KYFHCAFDNYETLAHVEGTRVVCESPPQDQLPSSTEGTDHVTVPLALMFEDVSVAVTNFS
FYDCKATGALDVAAPCSACVRSPWRCHWCPQRAFCVYGDGCPDGEKTVYHAQEADVLMKG
PDFCPQVEGLSTSHLVPVGWETRLALRVRNLHHYQSKAASYHCWLELPXXXXXXXXXXXX
XXXXXXXXXXXXXXFRPSPPRKELRVPIYVTRGNTHRVDNANDIYVTLYDCTVGHEDCSH
CQAADKNLSCVWCAQGRPVCNYRPLCPPEAVESLCPLPSIHLIKPLTGPPEGGVVITILG
SNLGSRLEDVTDAVSVAGRPCLLDPTLYRISTQIVCVTSPAPKDTTGPIKVTIKNRPPSE
SAQFFTYQDPVLSALSPWQGPKAGGTLLTIFGQHLLTESNIRAFLGDEPCLIQGPVCPEA
IVCLTGPRAIPGEADLRVVFGLAQRTLAKGHFSYKSDPQLLSAEPSVSFRGGGRMIRVTG
TNLDVVQKPQLSVWLEEAPAGPQQLEPKRSCEAPGMASQTCSWLEAGLLECSTVCLANSS
RLLLCPSPAVPGDARLRRMFFTLDNILVDFINASGGKDFLYQPNPHLYPLSRDRPAHPYR
LKPGNVLDVEGEGLNLGISKEEVQVQIGKGECVVKTLTLTHLYCEPPMWAPPPLNSSSAL
PEFIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRKSKQ
AMRDYKKVLVQLENLEISVGDQCRKEFTDLMTEMTDVSSDLEGSGIPFLDYKTFTERVFF
PGHYGSPLRSEIDVPDARQATVKQGLSQLANMLNSKLFLIKFIHTLEEQPTFSQRDRCYV
ASLLSLALHGKLEYLTDIMKTLLSDLTAQYVHKNPKLMLRRTETMVEKLLTNWMSICLYS
FLKEVAGEPLYMLFRAIKYQVDKGPVDAVTGKAKRTLNDSRLLREDVEFWPLTLTVLVGP
GAGTGEPQRVPARVLNTDTITQVKEKVLDQVYKGTPFSQRPSVHTLDLEWRSGVAGHLTL
SDEDLTSVTQNQWKRLNTLQHYKVPDGATVGLIPRMHNGNSVSKSPNQSFLSGESLPMLE
DGDESGIRLWHLVKSTEEPEVAKQRRSSLRERERAKAIPEIYLTRLLSMKXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLLRFWVNTLKNPQFI
FDVRVSDNVDAILTVIAQTFIDSCTISEHKVGRDSPVNKLLYAREIPRYKQMVEXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIISALEEDPVGQKMQ
LAYRLQQIAALVENKVTDL
Download sequence
Identical sequences ENSMEUP00000005662 ENSMEUP00000005662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]