SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006015 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006015
Domain Number 1 Region: 340-457
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.31e-32
Family Nuclear receptor ligand-binding domain 0.0000132
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000006015
Domain Number - Region: 82-93,208-274
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00102
Family Nuclear receptor ligand-binding domain 0.00048
Further Details:      
 
Domain Number - Region: 17-34
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0744
Family Nuclear receptor 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006015   Gene: ENSMEUG00000006583   Transcript: ENSMEUT00000006606
Sequence length 458
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4683:533:36562:-1 gene:ENSMEUG00000006583 transcript:ENSMEUT00000006606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYSYDEDLDELXXXXGDKVSGYHYGLLTCESCKXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGFKL
ETGPSMGPPPQTDYPLAPALHPGAKGLAPAPPAGPPGDYGAPGVPMAVPTHGPLAGYLYP
AFPGRAIKSEYPEPYASPHEPAPPYGYPEPYPSGPGLPGVPELILKLLQLEPDEGQLKAR
ILACLQEPSKGRPDRPTPFGLMCKMADQTLFSIVXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXVDLSTVAAQAGSLLHSLVLRAQDLVQQLHSLQV
DRQEFVCLKFLILFSLDVKFLENHGLAKDAQEKANSALLEYTMCHYPHCGDKFRQLLLRL
AEVRSLSMQAEEYLYHKHLGGEVPCNNLLIEMLHAKRT
Download sequence
Identical sequences ENSMEUP00000006015 ENSMEUP00000006015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]