SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006153 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006153
Domain Number 1 Region: 4-103
Classification Level Classification E-value
Superfamily SRCR-like 2.35e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0017
Further Details:      
 
Domain Number 2 Region: 104-201
Classification Level Classification E-value
Superfamily SRCR-like 9.02e-19
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006153   Gene: ENSMEUG00000006751   Transcript: ENSMEUT00000006759
Sequence length 204
Comment pep:novel scaffold:Meug_1.0:Scaffold87706:5488:6959:1 gene:ENSMEUG00000006751 transcript:ENSMEUT00000006759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLAFRPNPCDGVVLVKHQESWGFVCNEVWTLAEASVICRQLGCGSAIGAPKYVPLPGESL
QPWLHGVSCKGNESTFWECHLGEWSQKNCSYEWVVVVLCSNGTFREIRLLKGNSPCAGLP
EIRNENGIDRLCGLHMEEATVFCQELKCGPAVQAPRQGLGETQKYMTCNGTEPTIRNCRL
NNKFRSGCQLQLDAEVICAGKSTT
Download sequence
Identical sequences ENSMEUP00000006153 ENSMEUP00000006153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]