SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006187 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006187
Domain Number 1 Region: 600-855
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.07e-78
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000252
Further Details:      
 
Domain Number 2 Region: 169-315
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-18
Family Third domain of FERM 0.0016
Further Details:      
 
Domain Number 3 Region: 2-66
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000806
Family First domain of FERM 0.0028
Further Details:      
 
Domain Number 4 Region: 475-546
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000158
Family PDZ domain 0.00031
Further Details:      
 
Domain Number 5 Region: 111-171
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000353
Family Second domain of FERM 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006187   Gene: ENSMEUG00000006765   Transcript: ENSMEUT00000006798
Sequence length 862
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_785:7610:141196:-1 gene:ENSMEUG00000006765 transcript:ENSMEUT00000006798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KQDTGQVLLDMAFNHLGITEKEYFGLQHGEDSVDSPRWLESSKPIRKQLKGPFPCTLNFR
VRFFIPDPNTLQQEQTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHFGDHNSSLH
LSGYLSDSQFIPDQNKDFVTRVESLHEQHSGLKQSEAESCFINIARTLEFYGVELHSGRD
LHNLDLTIGVAAAGIAVYRKHICTSFYPXXXXXXXXXXXXXXXXXXXXXXDEAREHIIAF
NMLNYRSCKNLWKSCVDHHTFFQAKKTISHERNIQTQYWTLGSKNPKKSLNNQHCRKVIG
GMVWNPTKRRSLSVEHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLASETTYL
TETEDVFYTYKVSPSSKDSDSEFSQNRSPQRQSELEDSPNSQTQTSSSTLSHAPGCCSLD
GVDHQLLDTYASVSKGSFTEDSNQYYCEKXXXXXXXXXXXXXXXXXXXXXXXXXXGGVDQ
KMPLVVSRISPESPADKCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHTRELA
LLIRRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
QLYRKKPGLPITFAKLSQNLDKNRYKDVLPYDTTRVVLQENEEYINASYVNMEIPSTKIL
NRYIATQGPLPHTCVHFWQAIWDHKLSLIIMLTTLTERGRXXXXXXXXXXXXXXXXXXXX
XXXXSEVCTIAYVFREMLVTKIETGEEHTVTHLQYVAWPDHGVPEDSSDFLEFVTSMRTM
RVENEPILVHCSAGIGRTGVLVTMETAMCLIERSQPVYPLDIIRKMRDQRAMMVQTSSQY
KFVCEAILRVYKDRLVQPLDSS
Download sequence
Identical sequences ENSMEUP00000006187 ENSMEUP00000006187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]