SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006484 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006484
Domain Number 1 Region: 50-287
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.08e-70
Family Nuclear receptor ligand-binding domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006484   Gene: ENSMEUG00000007111   Transcript: ENSMEUT00000007119
Sequence length 288
Comment pep:known scaffold:Meug_1.0:Scaffold66576:9460:12311:1 gene:ENSMEUG00000007111 transcript:ENSMEUT00000007119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALPSQPPTRSMACLDRCRCCADHRRQSSILYSILKSEEPQERARAQGQGQGGTGRGTSCG
SQRRVALKSPQVACKAASAVLVKTLRFVKNVPCFQELPLDEQLVLVRSCWAPLLVLGLAQ
DRVHFETVETSEPSMLQRILTTRRRDPDGPEPPLSSLSSSPPAPPEPPALTDPLQVQAIK
GFLTKCWSLDISTKEYAYLKGTLLFNPDLPGLHCVQYIQGLQREAQQALNEHVQMLHRGH
QARFAKLNVALSLLRSINANVITELFFRPIIGTVNMDDMLLEMLCAKL
Download sequence
Identical sequences ENSMEUP00000006484 ENSMEUP00000006484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]